KEGG   Arabidopsis thaliana (thale cress): AT4G29840Help
Entry
AT4G29840         CDS       T00041                                 

Gene name
MTO2
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ath01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ath00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:ath00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
4
AA seq 526 aa AA seqDB search
MASSCLFNASVSSLNPKQDPIRRHRSTSLLRHRPVVISCTADGNNIKAPIETAVKPPHRT
EDNIRDEARRNRSNAVNPFSAKYVPFNAAPGSTESYSLDEIVYRSRSGGLLDVEHDMEAL
KRFDGAYWRDLFDSRVGKSTWPYGSGVWSKKEWVLPEIDDDDIVSAFEGNSNLFWAERFG
KQFLGMNDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRKMKRPVVGVGCASTGDTSAALS
AYCASAGIPSIVFLPANKISMAQLVQPIANGAFVLSIDTDFDGCMKLIREITAELPIYLA
NSLNSLRLEGQKTAAIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFKMCQELGLVDRIP
RMVCAQAANANPLYLHYKSGWKDFKPMTASTTFASAIQIGDPVSIDRAVYALKKCNGIVE
EATEEELMDAMAQADSTGMFICPHTGVALTALFKLRNQGVIAPTDRTVVVSTAHGLKFTQ
SKIDYHSNAIPDMACRFSNPPVDVKADFGAVMDVLKSYLGSNTLTS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgtcttgtctcttcaatgcctctgtatcgtccttaaaccctaaacaagacccc
atccgccgccaccggtcaacctctctcctccgccaccgccccgtcgtcatctcctgtacc
gccgatggcaacaacatcaaagccccgatcgagacagcggtcaagcctcctcaccgtacc
gaggataacattcgagatgaggctcgtcgtaatcgttccaacgccgtgaatccattttca
gctaaatacgttccgtttaatgcagctcctggatccacggagtcttactctctcgacgag
atcgtgtaccgtagccgctccggtggtttgcttgatgtcgaacacgatatggaggctttg
aagcgattcgatggcgcgtattggcgtgatctcttcgattcgcgtgttggtaaaagcaca
tggccttatggatcgggtgtttggtcgaagaaagagtgggttcttcctgagatcgatgac
gacgacatcgtttcagcttttgaaggaaactcgaatctgttctgggcagagagatttggt
aagcagtttctaggtatgaatgatctgtgggtgaaacactgtgggattagtcatacagga
agtttcaaggatcttggaatgactgttttggttagtcaagttaatcgtctgagaaagatg
aaacgacctgtggttggtgtcggatgtgcttccaccggagatacttctgctgctctatct
gcttactgcgcctccgctggaatcccatcgattgtgtttttaccggcgaacaagatctct
atggctcagctggttcagccgatagctaatggtgcgtttgttttgagtattgacactgat
tttgatgggtgtatgaagctgattagagagataactgcggaattgccgatttatttggcg
aattcgttgaatagtttgaggttagaagggcagaaaactgcagctattgagattttgcag
cagtttgattggcaagttcctgattgggtgattgttcctggaggtaacctaggaaacatc
tatgccttttacaaagggtttaagatgtgtcaagaactgggacttgtcgataggatcccg
aggatggtctgtgcacaagcagctaatgctaatcctctttacttgcactacaagtctggt
tggaaggacttcaagcccatgactgcaagtaccactttcgcctctgcgattcagatcggt
gaccctgtctccatcgatagagctgtgtacgctctcaagaagtgcaatggtattgtagaa
gaagccacagaggaggagctgatggatgcgatggctcaagcggattcgacaggaatgttt
atctgtcctcatacaggtgttgctctaactgctctgttcaagctgaggaatcaaggagtg
attgcaccgactgatcgaactgtggtagtgagtactgctcatgggttgaagtttactcag
tctaagatagattatcactccaatgccatccctgacatggcttgcagattctccaatcct
cctgttgatgtgaaagcagatttcggagctgtcatggatgttctcaagagttacttagga
agtaatacacttacgtcataa

DBGET integrated database retrieval system