KEGG   Arabidopsis thaliana (thale cress): AT4G29840Help
Entry
AT4G29840         CDS       T00041                                 

Gene name
MTO2
Definition
(RefSeq) Pyridoxal-5'-phosphate-dependent enzyme family protein
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT4G29840 (MTO2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AT4G29840 (MTO2)
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AT4G29840 (MTO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Structure
PDB: 

Jmol
Position
4
AA seq 526 aa AA seqDB search
MASSCLFNASVSSLNPKQDPIRRHRSTSLLRHRPVVISCTADGNNIKAPIETAVKPPHRT
EDNIRDEARRNRSNAVNPFSAKYVPFNAAPGSTESYSLDEIVYRSRSGGLLDVEHDMEAL
KRFDGAYWRDLFDSRVGKSTWPYGSGVWSKKEWVLPEIDDDDIVSAFEGNSNLFWAERFG
KQFLGMNDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRKMKRPVVGVGCASTGDTSAALS
AYCASAGIPSIVFLPANKISMAQLVQPIANGAFVLSIDTDFDGCMKLIREITAELPIYLA
NSLNSLRLEGQKTAAIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFKMCQELGLVDRIP
RMVCAQAANANPLYLHYKSGWKDFKPMTASTTFASAIQIGDPVSIDRAVYALKKCNGIVE
EATEEELMDAMAQADSTGMFICPHTGVALTALFKLRNQGVIAPTDRTVVVSTAHGLKFTQ
SKIDYHSNAIPDMACRFSNPPVDVKADFGAVMDVLKSYLGSNTLTS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgtcttgtctcttcaatgcctctgtatcgtccttaaaccctaaacaagacccc
atccgccgccaccggtcaacctctctcctccgccaccgccccgtcgtcatctcctgtacc
gccgatggcaacaacatcaaagccccgatcgagacagcggtcaagcctcctcaccgtacc
gaggataacattcgagatgaggctcgtcgtaatcgttccaacgccgtgaatccattttca
gctaaatacgttccgtttaatgcagctcctggatccacggagtcttactctctcgacgag
atcgtgtaccgtagccgctccggtggtttgcttgatgtcgaacacgatatggaggctttg
aagcgattcgatggcgcgtattggcgtgatctcttcgattcgcgtgttggtaaaagcaca
tggccttatggatcgggtgtttggtcgaagaaagagtgggttcttcctgagatcgatgac
gacgacatcgtttcagcttttgaaggaaactcgaatctgttctgggcagagagatttggt
aagcagtttctaggtatgaatgatctgtgggtgaaacactgtgggattagtcatacagga
agtttcaaggatcttggaatgactgttttggttagtcaagttaatcgtctgagaaagatg
aaacgacctgtggttggtgtcggatgtgcttccaccggagatacttctgctgctctatct
gcttactgcgcctccgctggaatcccatcgattgtgtttttaccggcgaacaagatctct
atggctcagctggttcagccgatagctaatggtgcgtttgttttgagtattgacactgat
tttgatgggtgtatgaagctgattagagagataactgcggaattgccgatttatttggcg
aattcgttgaatagtttgaggttagaagggcagaaaactgcagctattgagattttgcag
cagtttgattggcaagttcctgattgggtgattgttcctggaggtaacctaggaaacatc
tatgccttttacaaagggtttaagatgtgtcaagaactgggacttgtcgataggatcccg
aggatggtctgtgcacaagcagctaatgctaatcctctttacttgcactacaagtctggt
tggaaggacttcaagcccatgactgcaagtaccactttcgcctctgcgattcagatcggt
gaccctgtctccatcgatagagctgtgtacgctctcaagaagtgcaatggtattgtagaa
gaagccacagaggaggagctgatggatgcgatggctcaagcggattcgacaggaatgttt
atctgtcctcatacaggtgttgctctaactgctctgttcaagctgaggaatcaaggagtg
attgcaccgactgatcgaactgtggtagtgagtactgctcatgggttgaagtttactcag
tctaagatagattatcactccaatgccatccctgacatggcttgcagattctccaatcct
cctgttgatgtgaaagcagatttcggagctgtcatggatgttctcaagagttacttagga
agtaatacacttacgtcataa

DBGET integrated database retrieval system