KEGG   Arabidopsis thaliana (thale cress): AT4G30000Help
Entry
AT4G30000         CDS       T00041                                 

Definition
Dihydropterin pyrophosphokinase / Dihydropteroate synthase
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ath00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 561 aa AA seqDB search
MAPLLSQTLIHTGRFLLRRFLEPPPAVISAVAASRVCFHRYYSSKSLSLVSPLGLHCSSL
FSPPALCNSAFSSSATSTTIEVQSTEHEVVIALGSNIGNRMNNFREALRLMKRGGICVTR
HSCLYETAPVHVTDQPRFLNAAVRGVTKLGPHELLSVLKTIERDMGRKDGIRYGPRPLDL
DILFYGKMRISSDKLIIPHERLWERSFVLAPLVDLLGSAVDNDTVAHWHSLAIHPGGIFQ
AWERLGGESLIGQDGIQRVLPIGDKLWDFSNKTHVMGILNLTPDSFSDGGKFQSIDSAVS
RVRSMISEGADIIDIGAQSTRPMASRISSQEELDRLLPVLEAVRGMPEMEEKLISVDTFN
SEVASEAISNGADILNDVSAGTLDPNMHKVVAESGVPYMAMHMRGDPCTMQNKENLQYDD
VCKDVASELYLRVRDAELSGIPAWRVMIDPGIGFSKSVDHNLDIIMDLPKIREEMAKRSI
AVSHAPILVGPSRKRFLGDICGRPEATDRDAATVASVTAGILGGANIIRVHNVRHNADAA
KIDTAVSLCKNNMPREATFLL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggctcctttgctgtcacaaaccttaatacacaccggcagattccttctccgtcgcttc
ttagaaccacctccggcagtaatctctgctgtggctgcgagtcgcgtctgcttccatcga
tactattcgtcgaagtctctttctctcgtgtctccacttggcttgcactgttcctcttta
ttcagtcctccagcattatgtaactcagctttctcatcttcggcaacaagtacaactatc
gaagtacaatctacagagcatgaagttgtgattgctttaggaagtaacattggaaaccgg
atgaataatttcagagaggctttgcgattgatgaagcgtggtggcatttgtgtaaccagg
cacagttgtttgtacgaaacggctccggttcatgtgactgaccaacccaggtttctcaat
gctgcagtgagaggtgtcactaagcttggacctcatgagctattaagtgttctcaagact
attgagagagacatgggacgtaaggatggtattaggtatggaccaagaccgcttgacttg
gacatattgttctatgggaagatgagaattagttctgataagctgatcataccacatgag
agactctgggaaaggtcatttgtgttagcacctttggttgatttgcttggatcagctgtt
gataatgatacagttgctcattggcattcgctcgcgatacatcctggtggaattttccaa
gcgtgggagagactgggtggcgagtcactgattggacaagatggtatacaaagggtttta
ccaataggagataagctgtgggatttttctaacaaaactcatgtgatgggtatacttaat
cttacacctgacagctttagtgatggagggaaatttcaatcaatagattctgcagtttct
cgggttcgctcaatgatctctgagggtgcagatataattgatattggagcacagtccaca
cgcccaatggcctcaagaatttctagtcaagaagagttagatagactactaccagtttta
gaggctgttcgtggtatgccagagatggaggaaaagctcatatctgtggacactttcaac
tctgaggttgcttcagaagcaataagcaatggagctgacattctaaatgatgtatctgcg
ggaaccttagacccgaatatgcataaggttgttgcagaatctggggttccttatatggcc
atgcacatgagaggagatccatgtacaatgcagaacaaagagaatttgcagtatgatgat
gtctgcaaggatgttgcttctgaactctacttgagagtaagagatgcagaactctctggg
attccagcttggagggttatgatcgatccagggattgggttttccaagagcgtagatcat
aatctagatattattatggatcttccaaaaatccgagaagagatggctaagagaagtata
gcagtttctcatgcgcctatactcgtaggaccttcaaggaaaagatttctgggagatatt
tgtgggcgacctgaggccactgacagagatgctgcaactgttgcttctgtcactgcaggc
attctaggaggtgccaatatcatcagagttcataatgttagacataacgccgacgcagca
aaaatcgatacagcagtttcgctatgtaagaacaacatgccgagggaggcaacgtttctg
ctttga

DBGET integrated database retrieval system