KEGG   Arabidopsis thaliana (thale cress): AT4G30000Help
Entry
AT4G30000         CDS       T00041                                 

Definition
Dihydropterin pyrophosphokinase / Dihydropteroate synthase
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AT4G30000
Enzymes [BR:ath01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     AT4G30000
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     AT4G30000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 561 aa AA seqDB search
MAPLLSQTLIHTGRFLLRRFLEPPPAVISAVAASRVCFHRYYSSKSLSLVSPLGLHCSSL
FSPPALCNSAFSSSATSTTIEVQSTEHEVVIALGSNIGNRMNNFREALRLMKRGGICVTR
HSCLYETAPVHVTDQPRFLNAAVRGVTKLGPHELLSVLKTIERDMGRKDGIRYGPRPLDL
DILFYGKMRISSDKLIIPHERLWERSFVLAPLVDLLGSAVDNDTVAHWHSLAIHPGGIFQ
AWERLGGESLIGQDGIQRVLPIGDKLWDFSNKTHVMGILNLTPDSFSDGGKFQSIDSAVS
RVRSMISEGADIIDIGAQSTRPMASRISSQEELDRLLPVLEAVRGMPEMEEKLISVDTFN
SEVASEAISNGADILNDVSAGTLDPNMHKVVAESGVPYMAMHMRGDPCTMQNKENLQYDD
VCKDVASELYLRVRDAELSGIPAWRVMIDPGIGFSKSVDHNLDIIMDLPKIREEMAKRSI
AVSHAPILVGPSRKRFLGDICGRPEATDRDAATVASVTAGILGGANIIRVHNVRHNADAA
KIDTAVSLCKNNMPREATFLL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggctcctttgctgtcacaaaccttaatacacaccggcagattccttctccgtcgcttc
ttagaaccacctccggcagtaatctctgctgtggctgcgagtcgcgtctgcttccatcga
tactattcgtcgaagtctctttctctcgtgtctccacttggcttgcactgttcctcttta
ttcagtcctccagcattatgtaactcagctttctcatcttcggcaacaagtacaactatc
gaagtacaatctacagagcatgaagttgtgattgctttaggaagtaacattggaaaccgg
atgaataatttcagagaggctttgcgattgatgaagcgtggtggcatttgtgtaaccagg
cacagttgtttgtacgaaacggctccggttcatgtgactgaccaacccaggtttctcaat
gctgcagtgagaggtgtcactaagcttggacctcatgagctattaagtgttctcaagact
attgagagagacatgggacgtaaggatggtattaggtatggaccaagaccgcttgacttg
gacatattgttctatgggaagatgagaattagttctgataagctgatcataccacatgag
agactctgggaaaggtcatttgtgttagcacctttggttgatttgcttggatcagctgtt
gataatgatacagttgctcattggcattcgctcgcgatacatcctggtggaattttccaa
gcgtgggagagactgggtggcgagtcactgattggacaagatggtatacaaagggtttta
ccaataggagataagctgtgggatttttctaacaaaactcatgtgatgggtatacttaat
cttacacctgacagctttagtgatggagggaaatttcaatcaatagattctgcagtttct
cgggttcgctcaatgatctctgagggtgcagatataattgatattggagcacagtccaca
cgcccaatggcctcaagaatttctagtcaagaagagttagatagactactaccagtttta
gaggctgttcgtggtatgccagagatggaggaaaagctcatatctgtggacactttcaac
tctgaggttgcttcagaagcaataagcaatggagctgacattctaaatgatgtatctgcg
ggaaccttagacccgaatatgcataaggttgttgcagaatctggggttccttatatggcc
atgcacatgagaggagatccatgtacaatgcagaacaaagagaatttgcagtatgatgat
gtctgcaaggatgttgcttctgaactctacttgagagtaagagatgcagaactctctggg
attccagcttggagggttatgatcgatccagggattgggttttccaagagcgtagatcat
aatctagatattattatggatcttccaaaaatccgagaagagatggctaagagaagtata
gcagtttctcatgcgcctatactcgtaggaccttcaaggaaaagatttctgggagatatt
tgtgggcgacctgaggccactgacagagatgctgcaactgttgcttctgtcactgcaggc
attctaggaggtgccaatatcatcagagttcataatgttagacataacgccgacgcagca
aaaatcgatacagcagtttcgctatgtaagaacaacatgccgagggaggcaacgtttctg
ctttga

DBGET integrated database retrieval system