KEGG   Arabidopsis thaliana (thale cress): AT4G30210Help
Entry
AT4G30210         CDS       T00041                                 

Gene name
ATR2
Definition
NADPH--cytochrome P450 reductase 2
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     AT4G30210 (ATR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 711 aa AA seqDB search
MSSSSSSSTSMIDLMAAIIKGEPVIVSDPANASAYESVAAELSSMLIENRQFAMIVTTSI
AVLIGCIVMLVWRRSGSGNSKRVEPLKPLVIKPREEEIDDGRKKVTIFFGTQTGTAEGFA
KALGEEAKARYEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARF
YKWFTEGNDRGEWLKNLKYGVFGLGNRQYEHFNKVAKVVDDILVEQGAQRLVQVGLGDDD
QCIEDDFTAWREALWPELDTILREEGDTAVATPYTAAVLEYRVSIHDSEDAKFNDINMAN
GNGYTVFDAQHPYKANVAVKRELHTPESDRSCIHLEFDIAGSGLTYETGDHVGVLCDNLS
ETVDEALRLLDMSPDTYFSLHAEKEDGTPISSSLPPPFPPCNLRTALTRYACLLSSPKKS
ALVALAAHASDPTEAERLKHLASPAGKDEYSKWVVESQRSLLEVMAEFPSAKPPLGVFFA
GVAPRLQPRFYSISSSPKIAETRIHVTCALVYEKMPTGRIHKGVCSTWMKNAVPYEKSEN
CSSAPIFVRQSNFKLPSDSKVPIIMIGPGTGLAPFRGFLQERLALVESGVELGPSVLFFG
CRNRRMDFIYEEELQRFVESGALAELSVAFSREGPTKEYVQHKMMDKASDIWNMISQGAY
LYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQTSGRYLRDVW
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcttcttcttcttcgtcaacctccatgatcgatctcatggcagcaatcatcaaa
ggagagcctgtaattgtctccgacccagctaatgcctccgcttacgagtccgtagctgct
gaattatcctctatgcttatagagaatcgtcaattcgccatgattgttaccacttccatt
gctgttcttattggttgcatcgttatgctcgtttggaggagatccggttctgggaattca
aaacgtgtcgagcctcttaagcctttggttattaagcctcgtgaggaagagattgatgat
gggcgtaagaaagttaccatctttttcggtacacaaactggtactgctgaaggttttgca
aaggctttaggagaagaagctaaagcaagatatgaaaagaccagattcaaaatcgttgat
ttggatgattacgcggctgatgatgatgagtatgaggagaaattgaagaaagaggatgtg
gctttcttcttcttagccacatatggagatggtgagcctaccgacaatgcagcgagattc
tacaaatggttcaccgaggggaatgacagaggagaatggcttaagaacttgaagtatgga
gtgtttggattaggaaacagacaatatgagcattttaataaggttgccaaagttgtagat
gacattcttgtcgaacaaggtgcacagcgtcttgtacaagttggtcttggagatgatgac
cagtgtattgaagatgactttaccgcttggcgagaagcattgtggcccgagcttgataca
atactgagggaagaaggggatacagctgttgccacaccatacactgcagctgtgttagaa
tacagagtttctattcacgactctgaagatgccaaattcaatgatataaacatggcaaat
gggaatggttacactgtgtttgatgctcaacatccttacaaagcaaatgtcgctgttaaa
agggagcttcatactcccgagtctgatcgttcttgtatccatttggaatttgacattgct
ggaagtggacttacgtatgaaactggagatcatgttggtgtactttgtgataacttaagt
gaaactgtagatgaagctcttagattgctggatatgtcacctgatacttatttctcactt
cacgctgaaaaagaagacggcacaccaatcagcagctcactgcctcctcccttcccacct
tgcaacttgagaacagcgcttacacgatatgcatgtcttttgagttctccaaagaagtct
gctttagttgcgttggctgctcatgcatctgatcctaccgaagcagaacgattaaaacac
cttgcttcacctgctggaaaggatgaatattcaaagtgggtagtagagagtcaaagaagt
ctacttgaggtgatggccgagtttccttcagccaagccaccacttggtgtcttcttcgct
ggagttgctccaaggttgcagcctaggttctattcgatatcatcatcgcccaagattgct
gaaactagaattcacgtcacatgtgcactggtttatgagaaaatgccaactggcaggatt
cataagggagtgtgttccacttggatgaagaatgctgtgccttacgagaagagtgaaaac
tgttcctcggcgccgatatttgttaggcaatccaacttcaagcttccttctgattctaag
gtaccgatcatcatgatcggtccagggactggattagctccattcagaggattccttcag
gaaagactagcgttggtagaatctggtgttgaacttgggccatcagttttgttctttgga
tgcagaaaccgtagaatggatttcatctacgaggaagagctccagcgatttgttgagagt
ggtgctctcgcagagctaagtgtcgccttctctcgtgaaggacccaccaaagaatacgta
cagcacaagatgatggacaaggcttctgatatctggaatatgatctctcaaggagcttat
ttatatgtttgtggtgacgccaaaggcatggcaagagatgttcacagatctctccacaca
atagctcaagaacaggggtcaatggattcaactaaagcagagggcttcgtgaagaatctg
caaacgagtggaagatatcttagagatgtatggtaa

DBGET integrated database retrieval system