KEGG   Arabidopsis thaliana (thale cress): AT4G30890Help
Entry
AT4G30890         CDS       T00041                                 

Gene name
UBP24
Definition
ubiquitin carboxyl-terminal hydrolase 24
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AT4G30890 (UBP24)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AT4G30890 (UBP24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 551 aa AA seqDB search
MSEKKVFVFGSFTEHETRSFFEQKPTKDPQNSKDKCVGSIQFGSLNLAAENSSVNTNGEL
KKGEADGTVKSAGSQERLDASRPASSDKNNDSDAKLPRKNSLRVPEHVVQNGIIKEISES
NKSLNNGVAVKTDPIGLDNLSMSDGESDPVYKASSSKFQALDNEDFSSDSSSGSIQRKKN
LKVPTESVPPVKDFTPRGLINAGNLCFLNATLQALLSCSPFVQLLQKIQLQDIPKADSPT
LAAFSEFISELDVPSSSSIRNNVTVVEAGRPFRPAMFEGVLRNFTPDVLNNMSGRPRQED
AQEFLSFIMDQMHDELLKLKEQSPKVTASKSSVISSANDDGDEWETVGPKNKSAVTRTQS
FVPSELSEIFGGQLKSVVKAKGTKASATVQPYLLLHLDIHPDGVQGIEDALHLFSAQEDL
EGYRASVTGKTGVVSASKSIKIQKLSKIMILHLMRFSYGSQGSTKLRKGVKFPLELNLNR
SHLVSLSNESLRYELVATITHHGWDPSKGHYTTDARRKNGQWLRFDDASVTPIGTKLVLH
DQAYVLFYKQV
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaagaaggtatttgtgtttggatcctttacagaacatgaaactaggtcattt
tttgagcagaaacccactaaggatcctcagaattctaaagacaagtgtgtgggaagtatt
caatttggctccttgaatcttgctgcggaaaattcttcagtaaatactaatggcgagttg
aagaaaggtgaggctgatgggacagttaaatctgctgggtctcaagagagacttgatgct
tctagacctgccagctcggataagaacaatgatagtgatgcaaaactcccaagaaagaac
tctttgagagttccagagcatgtggtacaaaatggaatcataaaagagatctctgaaagc
aacaaatctctcaacaatggtgtggcggtgaaaacagatcctattggtttggataacttg
tctatgtctgatggtgaaagtgatcctgtgtataaagcttcgagctctaaatttcaagcg
ctggacaatgaagatttctcaagtgactcttcgtctggaagcattcaaagaaagaaaaac
ctgaaggttcctactgaatctgttccacctgttaaagactttacaccaagaggattaata
aacgctggaaacttgtgcttcctgaatgcaacactacaagcgttgctttcatgttctcct
tttgtgcagctcctccagaaaattcaactccaagatattccaaaggctgactctccaacc
ttagctgcattttccgagttcatctccgaattggatgtgccaagcagttccagcatcaga
aataacgttactgttgttgaggctggtagaccttttagacctgccatgttcgaaggagtc
cttagaaattttaccccagatgtactcaacaacatgtctggtaggccaaggcaggaagat
gctcaagagtttttgagttttataatggaccaaatgcatgatgagttgttgaaactcaag
gaacagtcccccaaagtcaccgcttctaagtcatcggttatttcttctgccaacgatgat
ggtgatgaatgggaaacagttggacccaaaaacaaatcagctgtgacaagaacacaaagt
tttgttccgtctgagcttagtgagatatttggcgggcagcttaaaagcgtagtgaaggca
aaaggaactaaagcttcggctactgtacagccgtatctcttgctacaccttgatattcat
ccggacggtgtgcaaggaatagaagacgcgttgcatttgttttctgcccaagaagatctt
gaaggatatagagcctcggttactgggaagactggtgtagtgagtgctagtaagtcgata
aagatacagaaactctcaaagataatgatactgcacctaatgcgttttagctacggaagc
caagggagtactaagctgcgtaaaggcgttaaatttccccttgaactcaacttaaaccgc
agccatcttgtttctctatccaatgagagtttgagatatgaacttgtggcaacaattacc
caccacggatgggatccctcaaaaggacactacaccacagatgctcgacgaaagaatggt
caatggctaaggtttgatgatgcctctgtgacccccatagggacaaaactggtgttgcac
gatcaagcctatgtcctcttctacaagcaagtgtaa

DBGET integrated database retrieval system