KEGG   Arabidopsis thaliana (thale cress): AT4G31810Help
Entry
AT4G31810         CDS       T00041                                 

Definition
(RefSeq) ATP-dependent caseinolytic (Clp) protease/crotonase family protein
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00280  Valine, leucine and isoleucine degradation
ath00410  beta-Alanine metabolism
ath00640  Propanoate metabolism
ath01100  Metabolic pathways
ath01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AT4G31810
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT4G31810
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT4G31810
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     AT4G31810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-GeneID: 829310
NCBI-ProteinID: NP_194909
MIPS: AT4G31810.1
TAIR: AT4G31810
Araport: AT4G31810
UniProt: Q8RXN4 A0A178UYS7
Position
4
AA seq 409 aa AA seqDB search
MQTVKALRRVSEPLQWVRSVSYGRRFSALPNYSASDADFEDQVLVEGKAKSRAAILNNPS
SLNALSAPMVGRLKRLYESWEENPAISFVLMKGSGKTFCSGADVLSLYHSINEGNTEESK
LFFENLYKFVYLQGTYLKPNIAIMDGVTMGCGGGISLPGMFRVATDKTVLAHPEVQIGFH
PDAGASYYLSRLPGYLGEYLALTGQKLNGVEMIACGLATHYCLNARLPLIEERIGKLLTD
DPAVIEDSLAQYGDLVYPDSSSVLHKIELIDKYFGLDTVEEIIEAMENEAANSCNEWCKK
TLKQIKEASPLSLKITLQSIREGRFQTLDQCLTHEYRISICGVSKVVSGDFCEGIRARLV
DKDFAPKWDPPRLEDVSKDMVDCYFTPASELDDSDSELKLPTAQREPYF
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacagtgaaagctttgaggagagtgagtgaacccttacaatgggttcggtctgtt
tcttatggaagacgcttttctgctctcccaaactattccgcatcagatgcagatttcgaa
gaccaggttctggtggaaggaaaagctaaatcaagagctgccattctcaataacccatct
tctctcaatgctctttctgcgcctatggttggtcggttaaagaggctatacgaatcatgg
gaagagaacccagctatttcctttgttttgatgaagggtagcggtaaaactttctgctct
ggtgcagatgtcttgtctctttatcactcgatcaatgaaggaaatactgaagaatctaaa
ctctttttcgagaacttgtacaagtttgtatacctccaaggaacgtatttaaaaccaaat
atagcaataatggatggtgtgaccatgggttgtggtggtggaatttcacttccagggatg
tttcgtgtggctacagataaaactgtgttggcccatccagaggtccaaattggttttcat
cctgatgcaggagcttcctattatctttcacggcttcctggttatttaggggaatacttg
gctctaacggggcagaaacttaatggtgtcgaaatgatagcatgtggccttgccacccac
tattgcttaaacgcgagacttccgttgattgaagagaggattggtaaactgttgaccgat
gatcctgctgtcattgaggattctcttgctcaatatggtgatcttgtttaccctgacagt
agcagcgtactgcacaagatagagttgattgataaatattttgggcttgataccgttgaa
gaaatcattgaagctatggaaaatgaagctgctaattcgtgcaatgaatggtgcaagaaa
actctcaaacagatcaaagaagcttcacctttgagcttaaagattactttgcaatctata
cgagaaggtagattccaaacccttgatcaatgtctcacacatgaataccgtatatccatt
tgtggagtctcaaaagtagtctctggcgacttttgcgagggtattcgagcccgtttggta
gataaagactttgctccaaagtgggatcctccacgcctagaagatgtgagcaaagacatg
gtggattgctacttcacgccagcctcagagctcgatgattcagattctgagttgaagctg
ccaacagctcaacgagagccttatttttga

DBGET integrated database retrieval system