KEGG   Arabidopsis thaliana (thale cress): AT4G31870Help
Entry
AT4G31870         CDS       T00041                                 

Gene name
GPX7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00480  Glutathione metabolism
ath00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AT4G31870 (GPX7)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AT4G31870 (GPX7)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AT4G31870 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin SCO1-SenC
Motif
Other DBs
NCBI-GeneID: 829316
NCBI-ProteinID: NP_194915
MIPS: AT4G31870.1
TAIR: AT4G31870
Araport: AT4G31870
UniProt: Q9SZ54
Position
4
AA seq 233 aa AA seqDB search
MAFSYASFSTPFNGFAANPSPITSAFLGPSLRFSTRTSKTRNPSNGVSVKSSNSHRFLVK
SKNFSVYARAAAEKSVHDFTVKDIDGNDVSLDKFKGKPLLIVNVASRCGLTSSNYSELSQ
LYEKYKNQGFEILAFPCNQFGGQEPGSNPEIKQFACTRFKAEFPIFDKVDVNGPSTAPIY
KFLKSNAGGFLGDIIKWNFEKFLVDKKGKVVERYPPTTSPFQIEKDIQKLLAA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggctttctcttacgcatcattctctacacccttcaatggtttcgctgcaaatccgtct
ccgattacttccgcttttctcggcccatcattgagattctccaccagaacatcaaaaact
cggaatccgagtaatggggtttcagtgaaatcgtcaaatagtcataggtttctagtcaaa
tctaaaaatttcagtgtctatgcaagggctgcagcagagaagtctgttcacgatttcact
gtaaaggacatcgatggtaatgatgtttctctggacaaattcaaaggaaaacctttgttg
atcgttaacgttgcgtcaagatgtggtttgacatcatcaaattactcagagctttctcaa
ctgtacgaaaaatacaagaaccaaggatttgagattcttgctttcccttgcaatcaattt
ggaggtcaagaacccggttcaaaccctgagatcaagcaatttgcttgcacccggttcaaa
gcagagttccctatattcgacaaggttgatgtgaatggaccaagcacagctccaatctac
aagttcttgaaatccaatgctggtggtttccttggtgatatcatcaaatggaactttgag
aaattcttggttgataaaaagggcaaagttgtcgagagataccctcccacaacttctcct
ttccaaatcgagaaggacatccagaagttgcttgcggcttaa

DBGET integrated database retrieval system