KEGG   Arabidopsis thaliana (thale cress): AT4G32040Help
Entry
AT4G32040         CDS       T00041                                 

Gene name
KNAT5
Definition
(RefSeq) homeobox protein knotted-1-like 5
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: KNOX2 Homeobox_KN KNOX1 ELK Homeobox
Motif
Other DBs
NCBI-GeneID: 829335
NCBI-ProteinID: NP_194932
MIPS: AT4G32040.1
TAIR: AT4G32040
Araport: AT4G32040
UniProt: P48002 A0A178V1Z3
Position
4
AA seq 383 aa AA seqDB search
MSFNSSHLLPPQEDLPLRHFTDQSQQPPPQRHFSETPSLVTASFLNLPTTLTTADSDLAP
PHRNGDNSVADTNPRWLSFHSEMQNTGEVRSEVIDGVNADGETILGVVGGEDWRSASYKA
AILRHPMYEQLLAAHVACLRVATPVDQIPRIDAQLSQLHTVAAKYSTLGVVVDNKELDHF
MSHYVVLLCSFKEQLQHHVCVHAMEAITACWEIEQSLQSLTGVSPSESNGKTMSDDEDDN
QVESEVNMFDGSLDGSDCLMGFGPLVPTERERSLMERVKKELKHELKQGFKEKIVDIREE
IMRKRRAGKLPGDTTSVLKEWWRTHSKWPYPTEEDKAKLVQETGLQLKQINNWFINQRKR
NWNSNSSTSSTLTKNKRKRTGKS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttaacagctcccacctccttcctccacaagaagaccttcctctccgacacttc
accgatcaatcacagcaacctccgccgcagcgtcacttctctgaaacaccttcgcttgtc
accgccagtttcctcaacctccctaccacccttaccactgcggattccgatctcgctcct
ccgcaccgcaacggagacaattccgttgctgatacaaacccacgctggctctcctttcat
tcggagatgcaaaatactggagaagtacgttctgaagttatcgacggagtcaacgccgat
ggtgaaacgatactcggcgttgtaggaggtgaagattggcggagtgctagctataaggcg
gcgattttaagacatccgatgtacgagcagcttcttgcggctcacgtggcttgccttagg
gttgcgactcccgttgaccagattccgaggatcgatgctcagctcagtcagttgcatacc
gtcgccgcgaaatactccactcttggtgtggttgttgacaacaaggaacttgatcatttc
atgtcacattatgttgtcttgttatgttcatttaaagaacaactccaacaccacgtttgt
gtccatgcaatggaagccattacggcttgttgggagattgaacaatcactgcaatcccta
actggagtttctccaagtgaaagtaatggtaagacaatgtcggatgatgaagatgataat
caagtagagagcgaggtgaacatgtttgatggaagtttggacggttcagattgcttgatg
gggtttggtcctcttgttccaaccgagagagagagatctttgatggaacgtgtgaagaaa
gaactgaagcatgagcttaaacagggtttcaaagagaagattgtggacataagagaagag
ataatgaggaagagaagggcgggaaagttgccaggagatacgacttctgtactcaaagaa
tggtggcgaactcactcgaaatggccatacccaactgaggaagataaggcaaaactggtt
caagaaaccggtttgcagttgaaacagatcaacaattggttcatcaaccagaggaaaaga
aactggaacagcaactcttccacgtcatctactctcaccaagaacaaacgtaaacggacc
gggaagtcgtag

DBGET integrated database retrieval system