KEGG   Arabidopsis thaliana (thale cress): AT4G32040Help
Entry
AT4G32040         CDS       T00041                                 

Gene name
KNAT5
Definition
(RefSeq) homeobox protein knotted-1-like 5
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 383 aa AA seqDB search
MSFNSSHLLPPQEDLPLRHFTDQSQQPPPQRHFSETPSLVTASFLNLPTTLTTADSDLAP
PHRNGDNSVADTNPRWLSFHSEMQNTGEVRSEVIDGVNADGETILGVVGGEDWRSASYKA
AILRHPMYEQLLAAHVACLRVATPVDQIPRIDAQLSQLHTVAAKYSTLGVVVDNKELDHF
MSHYVVLLCSFKEQLQHHVCVHAMEAITACWEIEQSLQSLTGVSPSESNGKTMSDDEDDN
QVESEVNMFDGSLDGSDCLMGFGPLVPTERERSLMERVKKELKHELKQGFKEKIVDIREE
IMRKRRAGKLPGDTTSVLKEWWRTHSKWPYPTEEDKAKLVQETGLQLKQINNWFINQRKR
NWNSNSSTSSTLTKNKRKRTGKS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttaacagctcccacctccttcctccacaagaagaccttcctctccgacacttc
accgatcaatcacagcaacctccgccgcagcgtcacttctctgaaacaccttcgcttgtc
accgccagtttcctcaacctccctaccacccttaccactgcggattccgatctcgctcct
ccgcaccgcaacggagacaattccgttgctgatacaaacccacgctggctctcctttcat
tcggagatgcaaaatactggagaagtacgttctgaagttatcgacggagtcaacgccgat
ggtgaaacgatactcggcgttgtaggaggtgaagattggcggagtgctagctataaggcg
gcgattttaagacatccgatgtacgagcagcttcttgcggctcacgtggcttgccttagg
gttgcgactcccgttgaccagattccgaggatcgatgctcagctcagtcagttgcatacc
gtcgccgcgaaatactccactcttggtgtggttgttgacaacaaggaacttgatcatttc
atgtcacattatgttgtcttgttatgttcatttaaagaacaactccaacaccacgtttgt
gtccatgcaatggaagccattacggcttgttgggagattgaacaatcactgcaatcccta
actggagtttctccaagtgaaagtaatggtaagacaatgtcggatgatgaagatgataat
caagtagagagcgaggtgaacatgtttgatggaagtttggacggttcagattgcttgatg
gggtttggtcctcttgttccaaccgagagagagagatctttgatggaacgtgtgaagaaa
gaactgaagcatgagcttaaacagggtttcaaagagaagattgtggacataagagaagag
ataatgaggaagagaagggcgggaaagttgccaggagatacgacttctgtactcaaagaa
tggtggcgaactcactcgaaatggccatacccaactgaggaagataaggcaaaactggtt
caagaaaccggtttgcagttgaaacagatcaacaattggttcatcaaccagaggaaaaga
aactggaacagcaactcttccacgtcatctactctcaccaagaacaaacgtaaacggacc
gggaagtcgtag

DBGET integrated database retrieval system