KEGG   Arabidopsis thaliana (thale cress): AT4G32840Help
Entry
AT4G32840         CDS       T00041                                 

Gene name
PFK6
Definition
6-phosphofructokinase 6
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ath01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ath01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ath00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ath00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ath00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ath00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 462 aa AA seqDB search
MASNGVDEQIKLVEGPAGYVLEDVPHLSDYILDLPTYPNPLQSNAAYSVVRQYFVDEDDT
VQEKIVVHKDSPRGTHFRRAGPRQKVYFKPSDVRACIVTCGGLCPGLNTVIREIVCGLHF
MYGVTEVIGVDCGFRGFYSKNTVALTPKTVSDIHKRGGTILGTSRGGHDTSKIVDNIQDR
EINQVYIIGGDGTQKGANAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEA
QRAINAAHVEATSVENGIGIVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGL
YEFIAKRLRENGHMVIVIAEGAGQDLVAESIEQQDASGNKLLKDVGLWMSLKIKEYFAKH
NVMDITLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLVNGRHTYIP
FNRITERQNKVVITDRMWARMLSSTNQPSFMNPPKGTTEFTD
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcttctaatggcgtggacgagcagattaagttggtggaaggacctgctggttatgta
ctcgaagatgttcctcatttgagcgattacattctcgatctccccacttatccaaacccg
ttgcaatcaaatgctgcttattcagtagtaaggcagtattttgttgatgaggatgataca
gtccaggaaaagattgttgttcacaaggattctcctagagggacacattttagacgtgca
ggcccgcgccaaaaggtgtacttcaagccatctgatgtgcgtgcctgtattgtcacttgt
ggtggcctatgccccgggcttaatacagttatcagggagatcgtgtgtggtcttcatttt
atgtatggtgttacagaagtgattggtgtggattgcgggtttcgcgggttctattctaaa
aacactgttgcactaacgccgaagactgtgagtgacatccacaagcgcgggggaaccata
ctaggaacctcccgagggggacatgatacatcaaagattgtcgacaacatacaagatcgt
gaaataaatcaggtttacattattggaggtgatggaacccaaaagggagcaaatgcaata
tataaggaaattaggcgccgtggacttaaagttgcagttgcaggaataccaaaaaccatt
gacaacgacatcccagtcattgacaagtcctttggatttgatactgcggttgaggaggct
caacgtgctattaatgcagcgcatgttgaagcgaccagtgtggaaaacggcattggaatt
gtcaagctaatgggtcggtacagtgggttcattgcaatgtatgctactctggctagccga
gatgttgactgctgtctgattcccgagtcacccttttaccttgaaggcaaaggagggctc
tatgagttcattgcaaaacgtctcagagaaaatggccacatggttatagtgattgctgaa
ggagcaggacaggatcttgttgcagagagcattgaacaacaagatgcttcaggaaacaag
ctccttaaagatgtaggactatggatgagtcttaaaatcaaggaatactttgcgaagcac
aatgtaatggacattactcttaaatacattgatccgacatacatgatccgagctattcca
gccaatgcatctgacaacgtctactcaactctccttgcccaaagcgcagtccatggtgca
atggctggctataccggctttgtctctggtcttgttaatggaaggcacacctacattccc
tttaaccgaataaccgaaagacagaacaaagttgtgattacagatagaatgtgggcgcga
atgttgtcatctacaaaccagcccagcttcatgaaccctcctaaaggaaccacggagttt
accgactaa

DBGET integrated database retrieval system