KEGG   Arabidopsis thaliana (thale cress): AT4G32840Help
Entry
AT4G32840         CDS       T00041                                 

Gene name
PFK6
Definition
6-phosphofructokinase 6
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT4G32840 (PFK6)
   01230 Biosynthesis of amino acids
    AT4G32840 (PFK6)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT4G32840 (PFK6)
   00030 Pentose phosphate pathway
    AT4G32840 (PFK6)
   00051 Fructose and mannose metabolism
    AT4G32840 (PFK6)
   00052 Galactose metabolism
    AT4G32840 (PFK6)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AT4G32840 (PFK6)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AT4G32840 (PFK6)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AT4G32840 (PFK6)
Messenger RNA biogenesis [BR:ath03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AT4G32840 (PFK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 462 aa AA seqDB search
MASNGVDEQIKLVEGPAGYVLEDVPHLSDYILDLPTYPNPLQSNAAYSVVRQYFVDEDDT
VQEKIVVHKDSPRGTHFRRAGPRQKVYFKPSDVRACIVTCGGLCPGLNTVIREIVCGLHF
MYGVTEVIGVDCGFRGFYSKNTVALTPKTVSDIHKRGGTILGTSRGGHDTSKIVDNIQDR
EINQVYIIGGDGTQKGANAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEA
QRAINAAHVEATSVENGIGIVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGL
YEFIAKRLRENGHMVIVIAEGAGQDLVAESIEQQDASGNKLLKDVGLWMSLKIKEYFAKH
NVMDITLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLVNGRHTYIP
FNRITERQNKVVITDRMWARMLSSTNQPSFMNPPKGTTEFTD
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcttctaatggcgtggacgagcagattaagttggtggaaggacctgctggttatgta
ctcgaagatgttcctcatttgagcgattacattctcgatctccccacttatccaaacccg
ttgcaatcaaatgctgcttattcagtagtaaggcagtattttgttgatgaggatgataca
gtccaggaaaagattgttgttcacaaggattctcctagagggacacattttagacgtgca
ggcccgcgccaaaaggtgtacttcaagccatctgatgtgcgtgcctgtattgtcacttgt
ggtggcctatgccccgggcttaatacagttatcagggagatcgtgtgtggtcttcatttt
atgtatggtgttacagaagtgattggtgtggattgcgggtttcgcgggttctattctaaa
aacactgttgcactaacgccgaagactgtgagtgacatccacaagcgcgggggaaccata
ctaggaacctcccgagggggacatgatacatcaaagattgtcgacaacatacaagatcgt
gaaataaatcaggtttacattattggaggtgatggaacccaaaagggagcaaatgcaata
tataaggaaattaggcgccgtggacttaaagttgcagttgcaggaataccaaaaaccatt
gacaacgacatcccagtcattgacaagtcctttggatttgatactgcggttgaggaggct
caacgtgctattaatgcagcgcatgttgaagcgaccagtgtggaaaacggcattggaatt
gtcaagctaatgggtcggtacagtgggttcattgcaatgtatgctactctggctagccga
gatgttgactgctgtctgattcccgagtcacccttttaccttgaaggcaaaggagggctc
tatgagttcattgcaaaacgtctcagagaaaatggccacatggttatagtgattgctgaa
ggagcaggacaggatcttgttgcagagagcattgaacaacaagatgcttcaggaaacaag
ctccttaaagatgtaggactatggatgagtcttaaaatcaaggaatactttgcgaagcac
aatgtaatggacattactcttaaatacattgatccgacatacatgatccgagctattcca
gccaatgcatctgacaacgtctactcaactctccttgcccaaagcgcagtccatggtgca
atggctggctataccggctttgtctctggtcttgttaatggaaggcacacctacattccc
tttaaccgaataaccgaaagacagaacaaagttgtgattacagatagaatgtgggcgcga
atgttgtcatctacaaaccagcccagcttcatgaaccctcctaaaggaaccacggagttt
accgactaa

DBGET integrated database retrieval system