KEGG   Arabidopsis thaliana (thale cress): AT4G33920Help
Entry
AT4G33920         CDS       T00041                                 

Definition
(RefSeq) Protein phosphatase 2C family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
4
AA seq 380 aa AA seqDB search
MLRALARPLERCLGSRASGDGLLWQSELRPHAGGDYSIAVVQANSRLEDQSQVFTSSSAT
YVGVYDGHGGPEASRFVNRHLFPYMHKFAREHGGLSVDVIKKAFKETEEEFCGMVKRSLP
MKPQMATVGSCCLVGAISNDTLYVANLGDSRAVLGSVVSGVDSNKGAVAERLSTDHNVAV
EEVRKEVKALNPDDSQIVLYTRGVWRIKGIIQVSRSIGDVYLKKPEYYRDPIFQRHGNPI
PLRRPAMTAEPSIIVRKLKPQDLFLIFASDGLWEHLSDETAVEIVLKHPRTGIARRLVRA
ALEEAAKKREMRYGDIKKIAKGIRRHFHDDISVIVVYLDQNKTSSSNSKLVKQGGITAPP
DIYSLHSDEAEQRRLLNVLY
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgagctttagcacggcctctcgaacggtgtttgggaagcagagctagtggtgat
ggtttactctggcaatcggaattgagacctcacgctggcggtgattattcgatcgcggtg
gttcaagccaattccaggcttgaagatcagagtcaggttttcacatcttcttctgctact
tacgtcggtgtatacgatggtcatggtggacctgaagcttctagattcgttaacagacat
ctctttccttatatgcacaaatttgcaagagaacatgggggattatctgtagatgttatc
aaaaaggcattcaaagaaacagaagaagagttttgtggtatggttaaacgatcccttccc
atgaaaccgcaaatggctactgtaggatcttgctgtcttgttggtgcaatctctaatgac
acactgtatgttgctaatcttggggactcgagagccgttcttggaagcgttgtttcaggg
gttgatagtaataaaggtgccgtagctgaacggttatctactgatcataatgttgctgtt
gaagaagtgagaaaggaggttaaggcacttaaccctgatgactcacaaatcgtcttatac
acacgtggagtttggcggattaaaggcattattcaggtatcgagatcaattggggatgta
tacttgaaaaaaccggagtattacagggacccgattttccagcgacatggaaatcccatt
cctttgaggagacccgcgatgacagccgaaccctccattatagtaaggaagcttaagcca
caggacttgtttctgatatttgcatcagatggtctctgggaacatcttagtgatgaaaca
gccgtagaaatcgtcctcaaacacccaagaactggtattgcccgaagacttgtaagagct
gctctggaagaagcggcaaagaagagagaaatgagatatggagatataaagaaaatagcc
aaaggaattcgacgacatttccatgacgacataagcgttattgtagtttatctagatcaa
aacaaaaccagttcatcgaatagtaaattggtgaagcaaggaggtatcaccgctccaccg
gatatctactcattacactctgatgaagcagagcaacgacggttactcaatgtgttatac
tga

DBGET integrated database retrieval system