KEGG   Arabidopsis thaliana (thale cress): AT4G34570Help
Entry
AT4G34570         CDS       T00041                                 

Gene name
THY-2
Definition
(RefSeq) thymidylate synthase 2
  KO
K13998  dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00240  Pyrimidine metabolism
ath00670  One carbon pool by folate
ath00790  Folate biosynthesis
ath01100  Metabolic pathways
Module
ath_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AT4G34570 (THY-2)
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AT4G34570 (THY-2)
   00670 One carbon pool by folate
    AT4G34570 (THY-2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AT4G34570 (THY-2)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     AT4G34570 (THY-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymidylat_synt DHFR_1 Spermine_synth
Motif
Other DBs
NCBI-GeneID: 829609
NCBI-ProteinID: NP_195183
MIPS: AT4G34570.1
TAIR: AT4G34570
Araport: AT4G34570
UniProt: Q05763 A0A178UZ11
Position
4
AA seq 565 aa AA seqDB search
MRCLQNSAKTLPLAFKSALLPLSQRWFCKFSPKPSSLTNIFKVSISTMANTLNGNVIMTS
KPQSTYQVVVAATKEMGIGKDGKLPWNLPTDLKFFKDLTLSTSDSAKKNAVVMGRKTWES
IPKKYRPLSGRLNVVLSRSSGFDIANTENVVTCSSIDSALDLLAAPPFSLSIEKVFVIGG
GDILREALNKPSCEAIHITEIDTSIDCDTFIPTVDTSAYQPWCSSFPICENGLRFSFTTH
VRVKSSSAGEASDESDGSKVLQVDWKKFSSVLPKMIFDRHEEYLYLNLVKEIISNGNLKD
DRTGTGTLSKFGCQMKFNLRRNFPLLTTKRVFWRGVVEELLWFISGSTNAKVLQEKGIRI
WDGNASRAYLDGIGLTEREEGDLGPVYGFQWRHFGAKYTDMHADYTGQGFDQLLDVINKI
KNNPDDRRIIMSAWNPSDLKLMALPPCHMFAQFYVANGELSCQMYQRSADMGLGVPFNIA
SYSLLTCILAHVCDLVPGDFIHVIGDAHVYKNHVRPLQEQLENPPKPFPVLKINPEKKDI
DSFVADDFELIGYDPHKKIDMKMAV
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgtttgcaaaactccgcaaagactctacctttagcgtttaaatcggcattgctg
cctttgtctcaaaggtggttctgtaaattttctcctaagccatcctcattgacaaacatt
ttcaaggtttcaatttcaaccatggcaaacactctcaatggaaatgtgatcatgacttca
aagcctcagagtacttaccaagttgtggtagctgcaaccaaggaaatgggtattggtaaa
gacggaaaacttccatggaatttgcctaccgatctcaagttcttcaaggatttaactttg
tccacttcggattctgctaagaagaacgctgttgttatgggtaggaaaacgtgggagtct
attcccaaaaagtataggccactctctggtcgcctgaatgttgtcttgtctcgttctagc
ggtttcgatatagccaacactgaaaatgttgtaacttgcagtagcatagattctgctcta
gacttattagctgcacctccgtttagtctgtccattgagaaagtgtttgtaataggaggt
ggcgacatattgagggaagctttgaataaaccgagctgtgaagccatccacataactgag
attgatacaagtatcgactgtgatacatttattcccacggttgacacttctgcatatcag
ccttggtgttcgtcgtttccaatatgtgaaaatggtcttcgattttccttcacgactcat
gttcgtgtaaagagttcttctgccggtgaagcctctgatgagagtgatgggtcaaaggtt
cttcaagttgattggaagaagttttcttctgttcttcctaaaatgatttttgaccggcat
gaggaatatctctacttaaatctggtcaaagagataatctcaaatggaaacttaaaagac
gataggacagggactggtacattatctaaatttggttgtcagatgaaattcaatttacgc
aggaattttccacttctgacgacaaagagagttttctggagaggtgttgttgaggaactt
ctatggttcataagcggttcaaccaatgcaaaggtacttcaagaaaagggtatccgtata
tgggatgggaatgcgtcgagagcatatcttgatggtattggactgactgagagagaggaa
ggtgaccttggacccgtttatggatttcagtggagacactttggtgctaagtacacagat
atgcatgctgattatactggccaaggatttgatcagctcttagatgtaattaacaagatc
aagaacaatcctgatgatcgacggattataatgtcagcttggaatccttctgatcttaag
ctgatggcacttcctccatgccacatgtttgcacagttttatgttgcaaatggagaactt
tcatgtcaaatgtatcagcgttcagccgatatgggtctcggcgtaccgtttaacattgcc
tcatactcccttcttacatgcattcttgctcacgtctgcgatcttgttcctggtgatttt
atccatgtgattggagatgctcatgtttacaaaaaccatgtcaggcctctgcaagagcaa
cttgagaacccaccaaaaccttttcctgttttgaagataaatccagagaagaaagatata
gattcttttgttgcggatgactttgagctcattggctatgatcctcacaagaaaatagat
atgaaaatggctgtttag

DBGET integrated database retrieval system