KEGG   Arabidopsis thaliana (thale cress): AT4G34570Help
Entry
AT4G34570         CDS       T00041                                 

Gene name
THY-2
Definition
bifunctional dihydrofolate reductase - thymidylate synthase
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ath00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ath00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ath00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 565 aa AA seqDB search
MRCLQNSAKTLPLAFKSALLPLSQRWFCKFSPKPSSLTNIFKVSISTMANTLNGNVIMTS
KPQSTYQVVVAATKEMGIGKDGKLPWNLPTDLKFFKDLTLSTSDSAKKNAVVMGRKTWES
IPKKYRPLSGRLNVVLSRSSGFDIANTENVVTCSSIDSALDLLAAPPFSLSIEKVFVIGG
GDILREALNKPSCEAIHITEIDTSIDCDTFIPTVDTSAYQPWCSSFPICENGLRFSFTTH
VRVKSSSAGEASDESDGSKVLQVDWKKFSSVLPKMIFDRHEEYLYLNLVKEIISNGNLKD
DRTGTGTLSKFGCQMKFNLRRNFPLLTTKRVFWRGVVEELLWFISGSTNAKVLQEKGIRI
WDGNASRAYLDGIGLTEREEGDLGPVYGFQWRHFGAKYTDMHADYTGQGFDQLLDVINKI
KNNPDDRRIIMSAWNPSDLKLMALPPCHMFAQFYVANGELSCQMYQRSADMGLGVPFNIA
SYSLLTCILAHVCDLVPGDFIHVIGDAHVYKNHVRPLQEQLENPPKPFPVLKINPEKKDI
DSFVADDFELIGYDPHKKIDMKMAV
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgtttgcaaaactccgcaaagactctacctttagcgtttaaatcggcattgctg
cctttgtctcaaaggtggttctgtaaattttctcctaagccatcctcattgacaaacatt
ttcaaggtttcaatttcaaccatggcaaacactctcaatggaaatgtgatcatgacttca
aagcctcagagtacttaccaagttgtggtagctgcaaccaaggaaatgggtattggtaaa
gacggaaaacttccatggaatttgcctaccgatctcaagttcttcaaggatttaactttg
tccacttcggattctgctaagaagaacgctgttgttatgggtaggaaaacgtgggagtct
attcccaaaaagtataggccactctctggtcgcctgaatgttgtcttgtctcgttctagc
ggtttcgatatagccaacactgaaaatgttgtaacttgcagtagcatagattctgctcta
gacttattagctgcacctccgtttagtctgtccattgagaaagtgtttgtaataggaggt
ggcgacatattgagggaagctttgaataaaccgagctgtgaagccatccacataactgag
attgatacaagtatcgactgtgatacatttattcccacggttgacacttctgcatatcag
ccttggtgttcgtcgtttccaatatgtgaaaatggtcttcgattttccttcacgactcat
gttcgtgtaaagagttcttctgccggtgaagcctctgatgagagtgatgggtcaaaggtt
cttcaagttgattggaagaagttttcttctgttcttcctaaaatgatttttgaccggcat
gaggaatatctctacttaaatctggtcaaagagataatctcaaatggaaacttaaaagac
gataggacagggactggtacattatctaaatttggttgtcagatgaaattcaatttacgc
aggaattttccacttctgacgacaaagagagttttctggagaggtgttgttgaggaactt
ctatggttcataagcggttcaaccaatgcaaaggtacttcaagaaaagggtatccgtata
tgggatgggaatgcgtcgagagcatatcttgatggtattggactgactgagagagaggaa
ggtgaccttggacccgtttatggatttcagtggagacactttggtgctaagtacacagat
atgcatgctgattatactggccaaggatttgatcagctcttagatgtaattaacaagatc
aagaacaatcctgatgatcgacggattataatgtcagcttggaatccttctgatcttaag
ctgatggcacttcctccatgccacatgtttgcacagttttatgttgcaaatggagaactt
tcatgtcaaatgtatcagcgttcagccgatatgggtctcggcgtaccgtttaacattgcc
tcatactcccttcttacatgcattcttgctcacgtctgcgatcttgttcctggtgatttt
atccatgtgattggagatgctcatgtttacaaaaaccatgtcaggcctctgcaagagcaa
cttgagaacccaccaaaaccttttcctgttttgaagataaatccagagaagaaagatata
gattcttttgttgcggatgactttgagctcattggctatgatcctcacaagaaaatagat
atgaaaatggctgtttag

DBGET integrated database retrieval system