KEGG   Arabidopsis thaliana (thale cress): AT4G35770Help
Entry
AT4G35770         CDS       T00041                                 

Gene name
SEN1
Definition
(RefSeq) senescence-associated protein DIN1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 182 aa AA seqDB search
METTAFNTTSRIGNWSSAISPPLQTCGSFKCQLPTRRGVIVADLRNSNFRWRKATTTSRG
NVAAEAVKIPTSVPVRVARELAQAGYRYLDVRTPDEFSIGHPTRAINVPYMYRVGSGMVK
NPSFLRQVSSHFRKHDEIIIGCESGQMSFMASTDLLTAGFTAITDIAGGYVAWTENELPV
EE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccactgcttttaacacaacatcacgaattggaaactggtcatcggctatttct
ccacctctacaaacatgtggatctttcaagtgccaattaccaacacgaagaggtgttatt
gtagctgatcttcgaaactcaaacttccgatggaggaaagcaacgacaacaagcagagga
aatgttgcagcagaggcagttaaaattcctacgtcagtaccagtaagagtggcgcgtgag
ctagctcaagcaggataccgctatctcgacgtgaggacaccagacgaattcagcatcgga
catccgactagagccatcaacgtaccttacatgtacagagtcggatcaggaatggttaag
aacccgagttttctaagacaggtctcgtcccacttcaggaaacacgatgaaatcataatc
ggttgtgagagcggtcaaatgtcatttatggcctcaactgatcttctcactgctggcttc
acggcgatcacagacattgctggaggatacgtcgcttggacagagaatgagctgccggta
gaagagtga

DBGET integrated database retrieval system