KEGG   Arabidopsis thaliana (thale cress): AT4G36670Help
Entry
AT4G36670         CDS       T00041                                 

Gene name
PMT6
Definition
(RefSeq) Major facilitator superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 YrhK DUF4504
Motif
Other DBs
NCBI-GeneID: 829820
NCBI-ProteinID: NP_195385
MIPS: AT4G36670.1
TAIR: AT4G36670
Araport: AT4G36670
UniProt: Q8GXR2 A4VCM1
Position
4
AA seq 493 aa AA seqDB search
MADQISGEKPAGVNRFALQCAIVASIVSIIFGYDTGVMSGAMVFIEEDLKTNDVQIEVLT
GILNLCALVGSLLAGRTSDIIGRRYTIVLASILFMLGSILMGWGPNYPVLLSGRCTAGLG
VGFALMVAPVYSAEIATASHRGLLASLPHLCISIGILLGYIVNYFFSKLPMHIGWRLMLG
IAAVPSLVLAFGILKMPESPRWLIMQGRLKEGKEILELVSNSPEEAELRFQDIKAAAGID
PKCVDDVVKMEGKKTHGEGVWKELILRPTPAVRRVLLTALGIHFFQHASGIEAVLLYGPR
IFKKAGITTKDKLFLVTIGVGIMKTTFIFTATLLLDKVGRRKLLLTSVGGMVIALTMLGF
GLTMAQNAGGKLAWALVLSIVAAYSFVAFFSIGLGPITWVYSSEVFPLKLRAQGASLGVA
VNRVMNATVSMSFLSLTSAITTGGAFFMFAGVAAVAWNFFFFLLPETKGKSLEEIEALFQ
RDGDKVRGENGAA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcaaatctccggcgagaagccggccggagttaatagattcgctcttcaatgt
gctatcgtcgcctccatcgtctccatcatctttggttacgatactggtgttatgagtgga
gcgatggtgtttatagaagaagatttgaagacaaacgacgttcaaatagaagttctcact
ggaattctcaacctttgtgcccttgtcggatcattgctcgccggaagaacgtcggacata
atcggacggcgttacacaatcgtcttggcctcaatactattcatgttaggctcaatattg
atgggttggggtccgaattatccggttctcctatccggtagatgcaccgctggactcgga
gtcggttttgctctgatggttgctccggtttactctgccgagatcgcaactgcttcacat
agaggactcttagcttctcttcctcacctttgtatcagtatagggattttactaggttat
atcgtgaattacttcttctccaagttacctatgcatatcggttggagactcatgctcggt
atagccgcggttccgtccctagtgctagcgttcgggatcttgaaaatgccggaatctcca
cggtggttgattatgcaaggccgtcttaaggaaggcaaggagatattggaattggtatct
aattcccctgaagaagcagaactccgctttcaagacatcaaagctgctgcgggaatcgac
ccgaaatgcgtagacgatgttgtgaaaatggagggtaagaagactcatggtgaaggagtg
tggaaagagctcattctaagaccaactcctgcagtgagacgtgttcttttaactgctctt
gggattcatttcttccaacacgcctccggaatcgaagcagtgcttttatacggtccgagg
atctttaagaaagcaggaatcacgactaaagacaagcttttcttggttactatcggtgtc
ggaatcatgaaaacgacgtttattttcactgcgactttattgttagacaaggtaggtcga
aggaagcttttgttgaccagcgttggaggaatggtcattgcgttgacaatgttgggattt
gggcttacaatggcccaaaatgctggcgggaaattagcgtgggctttagtactgagcata
gttgcggcttatagtttcgtggcgtttttctctattgggctcggcccaataacttgggtc
tacagttctgaggttttcccgttgaagcttagggcacaaggagcgagtctcggcgttgcg
gtgaacagagtaatgaacgccaccgtgtcgatgtcgtttttgtcgttgactagtgcgata
accaccggtggagctttctttatgttcgccggagttgcggcagtggcgtggaatttcttc
ttcttcctcttgccggagacgaaaggaaaatcacttgaagaaatcgaagcgctttttcaa
agagacggtgataaagtacgcggcgaaaacggtgcagcttag

DBGET integrated database retrieval system