KEGG   Arabidopsis thaliana (thale cress): AT4G37180Help
Entry
AT4G37180         CDS       T00041                                 

Definition
(RefSeq) Homeodomain-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-binding Mito_fiss_reg PRIMA1
Motif
Other DBs
NCBI-GeneID: 829872
NCBI-ProteinID: NP_849513
MIPS: AT4G37180.1
TAIR: AT4G37180
Araport: AT4G37180
UniProt: F4JRB0
Position
4
AA seq 363 aa AA seqDB search
MVQTETDQRMGLNLNLSIYSLPKPLSQFLDEVSRIKDNHSKLSEIDGYVGKLEEERNKID
VFKRELPLCMLLLNEEIVFLCVAIGALKDEARKGLSLMASNGKFDDVERAKPETDKKSWM
SSAQLWISNPNSQFRSTNEEEEDRCVSQNPFQTCNYPNQGGVFMPFNRPPPPPPPAPLSL
MTPTSEMMMDYSRIEQSHHHHQFNKPSSQSHHIQKKEQRRRWSQELHRKFVDALHRLGGP
QVATPKQIRDLMKVDGLTNDEVKSHLQKYRMHIRKHPLHPTKTLSSSDQPGVLERESQSL
ISLSRSDSPQSPLVARGLFSSNVGHSSEEDEEEEDEEEEKSDGRSSCRNDETKKKRQVLD
LEL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaacagaaaccgatcaaaggatgggtcttaatctgaatttgtctatctactct
ttaccaaaacccttatctcaatttctcgatgaagtgtcgaggatcaaagacaatcattcc
aaactgtctgaaatcgatggttatgtcggaaaattagaggaagaaaggaacaaaatcgat
gtttttaaacgagaactccctttatgcatgctcttattgaacgaagagattgtttttctc
tgtgtagcgattggggcgttgaaggatgaggctagaaaagggttatcactgatggcatct
aatgggaaattcgatgatgttgaaagggcaaaaccggaaactgataagaagagctggatg
agctctgcccagttatggatctcgaaccctaattcccaattccgatcgacaaatgaagaa
gaagaagatcggtgtgtgagtcagaacccatttcagacatgtaattaccctaatcaagga
ggggtatttatgccatttaaccgtcccccacctcctccaccaccagctcctctgtctctc
atgactccaacatcagagatgatgatggattatagcagaattgagcagagtcatcatcat
catcaattcaataaaccttcttcacagagtcatcacattcagaagaaagagcagagaagg
agatggtcacaggaacttcaccgtaaatttgttgatgctcttcataggcttggagggcca
caagttgctacaccaaagcagattagagatttgatgaaagttgatggtttaaccaatgat
gaagtcaagagccatttacaaaaatatagaatgcatatccgtaagcatccgctgcatccg
acaaagactttgtcatcgtcggatcagccaggtgtgttagagagagaatcgcagagctta
ataagtttgtcgaggtcggattcgccacaaagcccacttgttgcaagagggttgttcagt
agtaatgttggtcatagctcagaggaagatgaggaggaggaggatgaagaggaggagaag
tctgatggacgtagtagctgtagaaatgatgaaacaaagaagaagagacaagtgttggat
cttgagctttga

DBGET integrated database retrieval system