KEGG   Arabidopsis thaliana (thale cress): AT4G37380Help
Entry
AT4G37380         CDS       T00041                                 

Definition
(RefSeq) Tetratricopeptide repeat (TPR)-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR PPR_2 DYW_deaminase PPR_1 PPR_3 PPR_long
Motif
Other DBs
NCBI-GeneID: 829892
NCBI-ProteinID: NP_195454
MIPS: AT4G37380.1
TAIR: AT4G37380
Araport: AT4G37380
UniProt: Q9SZT8
Position
4
AA seq 632 aa AA seqDB search
MASSPLLATSLPQNQLSTTATARFRLPPPEKLAVLIDKSQSVDEVLQIHAAILRHNLLLH
PRYPVLNLKLHRAYASHGKIRHSLALFHQTIDPDLFLFTAAINTASINGLKDQAFLLYVQ
LLSSEINPNEFTFSSLLKSCSTKSGKLIHTHVLKFGLGIDPYVATGLVDVYAKGGDVVSA
QKVFDRMPERSLVSSTAMITCYAKQGNVEAARALFDSMCERDIVSWNVMIDGYAQHGFPN
DALMLFQKLLAEGKPKPDEITVVAALSACSQIGALETGRWIHVFVKSSRIRLNVKVCTGL
IDMYSKCGSLEEAVLVFNDTPRKDIVAWNAMIAGYAMHGYSQDALRLFNEMQGITGLQPT
DITFIGTLQACAHAGLVNEGIRIFESMGQEYGIKPKIEHYGCLVSLLGRAGQLKRAYETI
KNMNMDADSVLWSSVLGSCKLHGDFVLGKEIAEYLIGLNIKNSGIYVLLSNIYASVGDYE
GVAKVRNLMKEKGIVKEPGISTIEIENKVHEFRAGDREHSKSKEIYTMLRKISERIKSHG
YVPNTNTVLQDLEETEKEQSLQVHSERLAIAYGLISTKPGSPLKIFKNLRVCSDCHTVTK
LISKITGRKIVMRDRNRFHHFTDGSCSCGDFW
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgtcaccacttctcgccacgtcactaccgcagaatcagttatccaccaccgca
accgccagattccgccttccgccgccagagaaacttgcagttctaatcgacaaatcgcaa
tcagtagatgaagtgctccaaatccacgcagctattctccgtcataacctcctcctccac
cctcgttacccagttctaaacctcaagctccaccgtgcatacgcttcccacggcaaaatt
cgccactcgttggctttatttcaccagacgatcgatccagacttgttcctcttcaccgcc
gcaatcaacactgcctccattaacggcctcaaagaccaagccttcctgctttatgttcaa
ttgctttcttctgaaatcaaccccaatgagtttactttctcgtcgcttttgaaatcttgc
tcaactaagtccggaaaattgatccatacccatgttcttaaattcggattggggattgat
ccttacgtggcgactggtctcgtcgacgtttatgcgaaaggaggagatgtggtatctgcc
cagaaagtgttcgatagaatgcctgagaggagtctcgtttcttctacagctatgatcacc
tgctacgcaaagcaggggaacgtcgaggctgcgagagctttgttcgatagtatgtgtgag
agagacattgtttcttggaacgtgatgattgatggatacgctcaacatgggttccctaat
gacgctctgatgctatttcagaaacttttggccgaaggtaaaccaaaacctgatgaaata
accgttgtagctgctctttcagcgtgttcgcagattggagcgctggaaactgggcgttgg
atccatgtttttgtcaagagcagtcgtattaggctcaatgttaaagtatgtacgggtttg
attgatatgtatagcaaatgtgggagtttggaagaggcagttttagtttttaacgatact
ccaaggaaggatatcgtggcgtggaatgcgatgattgctggttatgcaatgcacggttat
agccaagatgcattgagattgtttaatgagatgcaagggatcacagggttgcaaccaacg
gatataactttcataggaacacttcaggcttgtgctcacgctggtttagtaaacgaaggg
ataagaatctttgagtcaatgggacaagagtatgggattaaacccaagattgaacattat
ggatgcttggtcagtctactcggtcgtgctggccagttaaaacgggcttacgaaaccata
aaaaacatgaacatggatgctgattctgtcttatggagttctgttctcggaagctgtaaa
cttcatggagattttgtgttaggcaaggaaattgcagagtatctcattggactaaacatc
aaaaactcaggaatttatgttcttctttcgaacatatatgcatcggtgggtgattatgaa
ggtgttgcaaaagtgaggaacttgatgaaggagaaaggaatagtgaaggagcctggtata
agcaccatagaaatcgaaaacaaagttcatgaattccgagctggagatagagaacactcg
aaaagcaaagaaatttacacaatgctaagaaagatcagcgagcggatcaagtctcatggt
tatgttccaaatacaaacacagtcttgcaggatcttgaagagacagagaaagagcaatct
ctacaagttcacagcgagagactcgcgattgcatacggtctaatcagcaccaaaccggga
agtcccttgaaaatattcaagaacctacgagtatgttctgattgtcatacggtgacaaaa
ctgatatcgaaaatcacaggacggaaaatcgttatgagagatcggaataggttccatcat
ttcacagatggttcttgctcttgtggcgatttctggtaa

DBGET integrated database retrieval system