KEGG   Arabidopsis thaliana (thale cress): AT4G38130Help
Entry
AT4G38130         CDS       T00041                                 

Gene name
HD1
Definition
(RefSeq) histone deacetylase 19
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AT4G38130 (HD1)
Chromosome [BR:ath03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     AT4G38130 (HD1)
   HDAC complexes
    Sin3A-HDAC complex
     AT4G38130 (HD1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    AT4G38130 (HD1)
  Chromatin remodeling factors
   NuRD complex
    AT4G38130 (HD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 501 aa AA seqDB search
MDTGGNSLASGPDGVKRKVCYFYDPEVGNYYYGQGHPMKPHRIRMTHALLAHYGLLQHMQ
VLKPFPARDRDLCRFHADDYVSFLRSITPETQQDQIRQLKRFNVGEDCPVFDGLYSFCQT
YAGGSVGGSVKLNHGLCDIAINWAGGLHHAKKCEASGFCYVNDIVLAILELLKQHERVLY
VDIDIHHGDGVEEAFYATDRVMTVSFHKFGDYFPGTGHIQDIGYGSGKYYSLNVPLDDGI
DDESYHLLFKPIMGKVMEIFRPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVKFMRSFN
VPLLLLGGGGYTIRNVARCWCYETGVALGVEVEDKMPEHEYYEYFGPDYTLHVAPSNMEN
KNSRQMLEEIRNDLLHNLSKLQHAPSVPFQERPPDTETPEVDEDQEDGDKRWDPDSDMDV
DDDRKPIPSRVKREAVEPDTKDKDGLKGIMERGKGCEVEVDESGSTKVTGVNPVGVEEAS
VKMEEEGTNKGGAEQAFPPKT
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggatactggcggcaattcgctggcgtccggacctgatggtgtgaagaggaaagtttgt
tatttctatgaccctgaggtcggcaattactactatggccaaggtcatcccatgaagccc
catcgcatccgcatgacccatgccctcctcgctcactacggtctccttcagcatatgcag
gttctcaagcccttccctgcccgcgaccgtgatctctgccgcttccacgccgacgactat
gtctcttttctccgcagcattacccctgaaacccagcaagatcagattcgccaacttaag
cgcttcaatgttggtgaagactgtcccgtctttgacggcctttattccttttgccagacc
tatgctggaggatctgttggtggctctgtcaagcttaaccacggcctctgcgatattgcc
atcaactgggctggtggtctccatcacgctaagaagtgcgaggcctctggcttctgttac
gtcaatgatatcgtcttagctatcctagagctccttaagcagcatgagcgtgttctttat
gtcgatattgatatccaccacggggatggagtggaggaggcattttatgctactgacagg
gttatgactgtctcgtttcataaatttggtgattactttcccggtacaggtcacattcag
gatataggttatggtagcggaaagtactattctctcaatgtaccactggatgatggaatc
gatgatgagagctatcatctgttattcaagcccatcatggggaaagttatggaaattttc
cgaccaggggctgtggtattgcaatgtggtgctgattcattgtctggtgataggttgggg
tgctttaatctttcaatcaaaggtcatgctgagtgcgtcaaatttatgagatcgttcaat
gttcccctactgctcttgggtggtggtggttacactatccgcaatgttgcccgttgctgg
tgctacgagactggagttgcacttggagttgaagttgaagacaagatgccggagcatgaa
tattatgaatactttggtccagactatacacttcacgttgctccaagtaacatggaaaat
aagaattctcgtcagatgcttgaagagattcgcaatgaccttctccacaatctctctaag
cttcagcatgctccaagtgtaccatttcaggaaagaccacctgatacagagactcccgag
gttgatgaagaccaagaagatggggataaaagatgggatccggattcagacatggatgtt
gatgatgaccgtaaacctataccaagcagagtaaaaagagaagctgttgaaccagataca
aaggacaaggatggactgaaaggaattatggagcgtggaaaaggttgtgaggtggaggtg
gatgagagtggaagcactaaggttacaggagtaaacccagtgggagtggaggaagcaagt
gtgaaaatggaagaggaaggaacaaacaagggtggggcggagcaggcgtttcctcctaaa
acataa

DBGET integrated database retrieval system