KEGG   Arabidopsis thaliana (thale cress): AT4G39330Help
Entry
AT4G39330         CDS       T00041                                 

Gene name
CAD9
Definition
(RefSeq) putative cinnamyl alcohol dehydrogenase 9
  KO
K00083  
cinnamyl-alcohol dehydrogenase [EC:1.1.1.195]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Phenylpropanoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Monolignol biosynthesis, phenylalanine/tyrosine  => monolignol
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT4G39330 (CAD9)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.195  cinnamyl-alcohol dehydrogenase
     AT4G39330 (CAD9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 360 aa AA seqDB search
MAKSPETEHPNKVFGWGARDKSGVLSPFHFSRRDNGENDVTVKILFCGVCHTDLHTIKND
WGYSYYPVVPGHEIVGIATKVGKNVTKFKEGDRVGVGVISGSCQSCESCDQDLENYCPQM
SFTYNAIGSDGTKNYGGYSENIVVDQRFVLRFPENLPSDSGAPLLCAGITVYSPMKYYGM
TEAGKHLGVAGLGGLGHVAVKIGKAFGLKVTVISSSSTKAEEAINHLGADSFLVTTDPQK
MKAAIGTMDYIIDTISAVHALYPLLGLLKVNGKLIALGLPEKPLELPMFPLVLGRKMVGG
SDVGGMKETQEMLDFCAKHNITADIELIKMDEINTAMERLAKSDVRYRFVIDVANSLSPP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatctccagaaacagagcatccgaacaaagtctttggttggggtgctagagac
aaatccggtgttctctctccttttcacttctctagaagagacaatggtgaaaatgatgtg
acagtgaagatcttgttctgtggagtttgccacactgatttacacaccatcaaaaacgac
tggggatactcgtattacccagtagttccagggcatgaaatcgttgggatcgctacaaaa
gttggtaagaacgtgactaaattcaaagaaggagatcgtgtcggagtaggagtgatcagt
ggctcgtgccaatcttgcgaatcttgtgaccaagatcttgaaaactactgtcctcaaatg
tctttcacatacaatgcgattggatccgatggaaccaagaattacggtggctattcggag
aacattgtggttgatcaacggtttgttttgcggtttccggagaatttaccgagcgattcg
ggtgcgccgttgctgtgtgctggaatcactgtgtatagtccaatgaagtattatggtatg
actgaggcagggaagcatttaggggttgctggacttggtgggcttggtcatgttgctgtt
aagattggtaaagcttttggtttgaaagttactgtcattagttcttcttctacgaaagca
gaggaagccattaatcatcttggtgctgattcgtttcttgtcacaactgatcctcagaaa
atgaaggctgcaattggaacaatggactacattatcgatacgatatcagcagtacatgct
ctgtatccgttgctcggtttactcaaagtcaacggaaagctcattgctttaggcttacct
gagaagcctctcgagctaccaatgttccctcttgttctcggaaggaaaatggttggagga
agtgacgtgggagggatgaaggagacacaagagatgcttgatttctgcgctaagcacaac
attacagctgatattgaattgattaagatggatgagattaacactgcgatggagaggctt
gctaagtctgatgttaggtacaggttcgtgatcgacgtggctaactccttgagccctcca
tga

DBGET integrated database retrieval system