KEGG   Arabidopsis thaliana (thale cress): AT4G39640Help
Entry
AT4G39640         CDS       T00041                                 

Gene name
GGT1
Definition
gamma-glutamyl transpeptidase 1
Orthology
K00681  
gamma-glutamyltranspeptidase [EC:2.3.2.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Taurine and hypotaurine metabolism
Cyanoamino acid metabolism
Glutathione metabolism
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AT4G39640 (GGT1)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AT4G39640 (GGT1)
   00460 Cyanoamino acid metabolism
    AT4G39640 (GGT1)
   00480 Glutathione metabolism
    AT4G39640 (GGT1)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     AT4G39640 (GGT1)
Peptidases [BR:ath01002]
 Threonine Peptidases
  Family T3: gamma-glutamyltransferase family
   AT4G39640 (GGT1)
Cellular antigens [BR:ath04090]
 Proteins
  AT4G39640 (GGT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 572 aa AA seqDB search
MSLVRTVTIVLFIIAFLQNAAAQKRQQSIVKSRGAVATDDGRCSVIGMRVLREGGNAIDA
SVAAALCLGVVSPASSGIGGGAFTVVKIAGGKEIAYDSRETAPLRATENMYGGNVDLKKK
GALSVGVPGEVAGLFTAWKQHGKLPWKRLVTPAEKLAEGFKISKYLYMQMNATRSDILAD
KGLSDLFVSNGELKKPGTICHNPKLALTLKLIGEYGPKAFYNGTVGVNLARDIKKSGGII
TLKDLQSYRVKIKEPLSADILGYRVLGMPPPSSGGAAMMLVLNILSQYGIPSGVSGPLGV
HRLIEALKHAFAVRMNLGDPDFTDVTKVVSDMLSPKFAKDLKSKINDQKTFDPKYYGGMW
NQIDDHGTSHLSIIDRERNAVSMTSTINGYFGALMLSPSTGIVLNNEMDDFSIPMKSNGN
LDVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAGTTEVYLNHFFLK
MDPLSSVLAPRIYHQLIPNRASYENWTTVFNDHFEIPKATRVVLEKKGHVLSPIAGGTIA
QFIVQESGENSGGRSELVAVSDPRKGGFPSGY
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctggttcgaacagtgacgatcgttctttttataatcgcgtttctgcaaaacgct
gcggctcagaaaagacagcaaagtattgttaagtctcgcggtgcggttgcgacagatgat
ggacggtgttctgttatcgggatgcgtgttcttcgtgaaggaggaaacgcgattgatgcg
tctgtggctgctgctctgtgtttgggcgttgtaagtcccgcgtctagcggtataggcggt
ggagcgtttacagtggttaagatagctggtgggaaagaaattgcttatgattctagagaa
accgctcctctaagagccactgagaatatgtatggaggtaatgttgacctaaagaagaaa
ggagccttatcagtaggcgttcccggggaagttgcaggtctattcacggcttggaaacaa
catgggaagctaccgtggaagcggttagtgactcctgcagagaaacttgcagagggattc
aagatttccaagtatctttatatgcagatgaacgcgactagaagcgatatcttagcagac
aaaggtctctctgacctatttgtttcaaatggagagctcaagaaaccagggacgatttgc
cataacccaaaattggctttaaccttgaagctaattggagagtacggtccaaaagcattt
tacaatggcacagttggggttaacctagcgagagatatcaaaaaatctggaggaataata
actttgaaagatctgcaaagttatagagttaagattaaagaaccgttgtctgcagacatt
cttggatatagagtccttggtatgcctcctccttcatctggtggcgctgcaatgatgctt
gttttgaacattctttctcaatatgggattccatcaggtgtttcaggccctctcggtgtt
catcgactaatcgaggctctgaaacatgcattcgcagttagaatgaacctcggggatcca
gatttcactgatgttaccaaggttgtttcggatatgttgtcgccaaagtttgcaaaagac
ttgaagagcaagataaacgaccaaaaaacttttgatccaaaatattacgggggcatgtgg
aatcagatcgacgaccacgggacaagtcatttatcgatcatagaccgcgagaggaacgct
gtgtctatgactagtacaataaatggttactttggggcattgatgctatctccgagcaca
ggaatagttctgaacaacgaaatggacgatttctcaatccctatgaaatctaacggtaac
ttagatgttccaccaccagcaccagctaacttcatccgtcctggaaaacgacctttgtcc
tctatgtcacccaccattgtactcaaggacggtaaagtgaaagccgctgtgggtgcgagc
ggaggagccaacattattgccgggacaacggaagtttacttgaatcattttttcctcaag
atggatcctctttcttccgtcttagctccaagaatctaccatcagctgataccaaacaga
gcttcgtacgagaactggacaacagtattcaatgatcatttcgagattcctaaagcaaca
agagttgtgttggagaagaaaggtcatgtcctatctcctattgccggagggacgattgct
cagttcatagttcaagaatccggtgagaactccggtggaagaagtgagcttgtggcagtt
agtgatcctcgaaaaggagggttcccttcaggatattga

DBGET integrated database retrieval system