KEGG   Arabidopsis thaliana (thale cress): AT4G39640Help
Entry
AT4G39640         CDS       T00041                                 

Gene name
GGT1
Definition
gamma-glutamyl transpeptidase 1
Orthology
K00681  
gamma-glutamyltranspeptidase [EC:2.3.2.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Taurine and hypotaurine metabolism
Cyanoamino acid metabolism
Glutathione metabolism
Arachidonic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ath00590]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:ath00430]
Metabolism; Metabolism of other amino acids; Cyanoamino acid metabolism [PATH:ath00460]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ath00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 572 aa AA seqDB search
MSLVRTVTIVLFIIAFLQNAAAQKRQQSIVKSRGAVATDDGRCSVIGMRVLREGGNAIDA
SVAAALCLGVVSPASSGIGGGAFTVVKIAGGKEIAYDSRETAPLRATENMYGGNVDLKKK
GALSVGVPGEVAGLFTAWKQHGKLPWKRLVTPAEKLAEGFKISKYLYMQMNATRSDILAD
KGLSDLFVSNGELKKPGTICHNPKLALTLKLIGEYGPKAFYNGTVGVNLARDIKKSGGII
TLKDLQSYRVKIKEPLSADILGYRVLGMPPPSSGGAAMMLVLNILSQYGIPSGVSGPLGV
HRLIEALKHAFAVRMNLGDPDFTDVTKVVSDMLSPKFAKDLKSKINDQKTFDPKYYGGMW
NQIDDHGTSHLSIIDRERNAVSMTSTINGYFGALMLSPSTGIVLNNEMDDFSIPMKSNGN
LDVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAGTTEVYLNHFFLK
MDPLSSVLAPRIYHQLIPNRASYENWTTVFNDHFEIPKATRVVLEKKGHVLSPIAGGTIA
QFIVQESGENSGGRSELVAVSDPRKGGFPSGY
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctggttcgaacagtgacgatcgttctttttataatcgcgtttctgcaaaacgct
gcggctcagaaaagacagcaaagtattgttaagtctcgcggtgcggttgcgacagatgat
ggacggtgttctgttatcgggatgcgtgttcttcgtgaaggaggaaacgcgattgatgcg
tctgtggctgctgctctgtgtttgggcgttgtaagtcccgcgtctagcggtataggcggt
ggagcgtttacagtggttaagatagctggtgggaaagaaattgcttatgattctagagaa
accgctcctctaagagccactgagaatatgtatggaggtaatgttgacctaaagaagaaa
ggagccttatcagtaggcgttcccggggaagttgcaggtctattcacggcttggaaacaa
catgggaagctaccgtggaagcggttagtgactcctgcagagaaacttgcagagggattc
aagatttccaagtatctttatatgcagatgaacgcgactagaagcgatatcttagcagac
aaaggtctctctgacctatttgtttcaaatggagagctcaagaaaccagggacgatttgc
cataacccaaaattggctttaaccttgaagctaattggagagtacggtccaaaagcattt
tacaatggcacagttggggttaacctagcgagagatatcaaaaaatctggaggaataata
actttgaaagatctgcaaagttatagagttaagattaaagaaccgttgtctgcagacatt
cttggatatagagtccttggtatgcctcctccttcatctggtggcgctgcaatgatgctt
gttttgaacattctttctcaatatgggattccatcaggtgtttcaggccctctcggtgtt
catcgactaatcgaggctctgaaacatgcattcgcagttagaatgaacctcggggatcca
gatttcactgatgttaccaaggttgtttcggatatgttgtcgccaaagtttgcaaaagac
ttgaagagcaagataaacgaccaaaaaacttttgatccaaaatattacgggggcatgtgg
aatcagatcgacgaccacgggacaagtcatttatcgatcatagaccgcgagaggaacgct
gtgtctatgactagtacaataaatggttactttggggcattgatgctatctccgagcaca
ggaatagttctgaacaacgaaatggacgatttctcaatccctatgaaatctaacggtaac
ttagatgttccaccaccagcaccagctaacttcatccgtcctggaaaacgacctttgtcc
tctatgtcacccaccattgtactcaaggacggtaaagtgaaagccgctgtgggtgcgagc
ggaggagccaacattattgccgggacaacggaagtttacttgaatcattttttcctcaag
atggatcctctttcttccgtcttagctccaagaatctaccatcagctgataccaaacaga
gcttcgtacgagaactggacaacagtattcaatgatcatttcgagattcctaaagcaaca
agagttgtgttggagaagaaaggtcatgtcctatctcctattgccggagggacgattgct
cagttcatagttcaagaatccggtgagaactccggtggaagaagtgagcttgtggcagtt
agtgatcctcgaaaaggagggttcccttcaggatattga

DBGET integrated database retrieval system