KEGG   Arabidopsis thaliana (thale cress): AT5G02030Help
Entry
AT5G02030         CDS       T00041                                 

Gene name
RPL
Definition
(RefSeq) POX (plant homeobox) family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
5
AA seq 575 aa AA seqDB search
MADAYEPYHVLQQSRRDKLRIPSLDSHFHFHPPPPPSSGGGGGVFPLADSDFLAAGGFHS
NNNNNHISNPSYSNFMGFLGGPSSSSSTAVAVAGDHSFNAGLSSGDVLVFKPEPLSLSLS
SHPRLAYDLVVPGVVNSGFCRSAGEANAAAVTIASRSSGPLGPFTGYASILKGSRFLKPA
QMLLDEFCNVGRGIYTDKVIDDDDSSLLFDPTVENLCGVSDGGGGDNGKKKSKLISMLDE
VYKRYKQYYEQLQAVMGSFECVAGLGHAAPYANLALKALSKHFKCLKNAITDQLQFSHNN
KIQQQQQCGHPMNSENKTDSLRFGGSDSSRGLCSAGQRHGFPDHHAPVWRPHRGLPERAV
TVLRAWLFDHFLHPYPTDTDKLMLAKQTGLSRNQVSNWFINARVRVWKPMVEEIHMLETR
QSQRSSSSSWRDERTSTTVFPDNSNNNPSSSSAQQRPNNSSPPRRARNDDVHGTNNNNSY
VNSGSGGGSAVGFSYGIGSSNVPVMNSSTNGGVSLTLGLHHQIGLPEPFPMTTAQRFGLD
GGSGDGGGGYEGQNRQFGRDFIGGSNHQFLHDFVG
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgcatacgagccttatcatgttcttcaacaaagccggcgagacaaacttcgt
attccatctctcgattcccacttccactttcaccctcctcctcctccttcctccggcggc
ggaggtggcgtctttcctctcgctgattccgatttcctcgcagccggtggctttcactcc
aacaacaacaacaaccacatatctaaccctagctacagtaatttcatgggatttctcggt
ggcccttcttcttcttcatccaccgcagtcgccgtcgccggagatcattcctttaacgcc
ggactttcttccggagacgttcttgtcttcaaacccgagcctctatctctatctttgtcc
tctcaccctagactcgcttacgatctagtcgttcccggtgttgttaactccggattctgt
agatctgccggtgaagccaacgccgccgccgtcaccatcgcgtctagaagctctggtcct
ctcggacctttcacgggctacgcgtcgattcttaaaggatcaaggttcttgaaaccagca
cagatgcttcttgatgagttttgtaatgtgggtcgtgggatttacaccgacaaagtcatc
gacgacgatgattcttctctgctttttgatccgacggttgagaatctctgcggtgtttct
gatggcggcggaggagataatggaaagaaaaaatcaaaactcatctccatgctcgacgag
gtttacaagaggtataagcaatactatgagcagctacaagctgtgatgggatcattcgaa
tgcgttgcaggtctcgggcacgctgctccgtacgctaacttagccttgaaagcattgtct
aagcatttcaagtgtttgaagaatgctataacggaccagcttcaattcagccacaacaac
aagatccaacaacaacaacaatgtggtcatccgatgaactctgagaataagactgattct
ttaagatttggaggaagtgatagttctagaggcttatgttctgctggtcaaagacatgga
tttcctgatcatcatgctcctgtttggagaccgcaccgtggcctacccgaacgtgctgtt
actgttctaagggcttggctcttcgatcatttcttgcatccttatccaacagatacagac
aaactcatgctggctaagcagacaggtctctccagaaatcaggtatcgaattggttcata
aacgcaagagttagggtttggaagccgatggtggaagagattcacatgctggagactcga
caatctcagagatcttcttcttcctcttggagagacgaacgtactagcaccaccgtcttc
cctgacaacagcaacaacaacccatcttcgtcctcggcacagcaaagacctaacaactca
tctccgcctagacgggcacgaaacgacgacgttcatggcacaaacaacaacaacagctat
gtaaacagtgggagcggcggcggtagtgcggttggtttctcgtatggaattgggtcgtcg
aatgtgccggtgatgaatagcagcacaaacggaggagtgtctttgacgttagggcttcat
catcagattgggttaccggagccttttccgatgacaactgctcagaggtttgggcttgat
ggtggtagtggcgatggtggtggtgggtatgaagggcaaaatcgtcagtttgggagagat
tttattggtggtagtaatcatcagtttctacatgattttgtaggttga

DBGET integrated database retrieval system