KEGG   Arabidopsis thaliana (thale cress): AT5G02570Help
Entry
AT5G02570         CDS       T00041                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT5G02570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 132 aa AA seqDB search
MAPKAEKKPAEKAPAPKAEKKIAKEGGTSEIVKKKKKTKKSTETYKIYIFKVLKQVHPDI
GISGKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLVLPGELAKHAVS
EGTKAVTKFTSS
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgaaggcagagaagaaaccggcggagaaagcaccagcaccaaaggcggagaag
aagatcgcgaaagaaggaggaacgagcgagattgtcaagaagaagaagaagacgaagaag
agcacagagacgtacaagatctacattttcaaggtattgaaacaggttcatccagatatt
ggaatctctggtaaagcgatgggaatcatgaacagtttcatcaacgacattttcgagaaa
ctcgctcaggaatcgtctcgtctcgctcgttacaataagaaaccgacgatcacgtctcgt
gaaatccaaaccgccgtgagacttgttctgcctggtgaattggctaagcatgccgtctct
gaaggaaccaaagctgtcaccaaattcacaagctcttaa

DBGET integrated database retrieval system