KEGG   Arabidopsis thaliana (thale cress): AT5G03860Help
Entry
AT5G03860         CDS       T00041                                 

Gene name
MLS
Definition
(RefSeq) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00620  Pyruvate metabolism
ath00630  Glyoxylate and dicarboxylate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Module
ath_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AT5G03860 (MLS)
   00630 Glyoxylate and dicarboxylate metabolism
    AT5G03860 (MLS)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AT5G03860 (MLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI PI3K_P85_iSH2
Motif
Other DBs
NCBI-GeneID: 831690
NCBI-ProteinID: NP_001190219
MIPS: AT5G03860.1
TAIR: AT5G03860
Araport: AT5G03860
UniProt: Q9LZC3 A0A178UKL7
Position
5
AA seq 562 aa AA seqDB search
MELETSVYRPNVAVYDSPDGVEVRGRYDQIFAKILTREALSFVAELQREFRGHVKYAMEC
RREARRRYNSGAVPGFDPSTKFIRDGDWSCASVPPAVADRRVEITGPVERKMIINALNSG
AKVFMADFEDALSPSWENLMRGHVNLKDAVDGSITFHDKSRNRVYKLNDQTAKLFVRPRG
WHLPEAHILIDGEPATGCLVDFGLYFFHNYAKFRQTQGSGFGPFFYLPKMEHSREAKIWN
SVFERAEKMAGIERGSIRATVLIETLPAVFQMNEILYELRDHSVGLNCGRWDYIFSYVKT
FQAHPDRLLPDRVLVGMGQHFMRSYSDLLIRTCHKRGVHAMGGMAAQIPIRDDPKANEMA
LDLVRKDKLREVRAGHDGTWAAHPGLIPICMEAFTGHMGKSPNQIKSVKREDAAAITEED
LLQIPRGVRTLEGLRLNTRVGIQYLAAWLTGSGSVPLYNLMEDAATAEISRVQNWQWIRY
GVELDGDGLGVRVSKELFGRVVEEEMERIEKEVGKDKFKNGMYKEACKMFTKQCTAPELD
DFLTLAVYNHIVAHYPINVSRL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggagctcgagacctcagtttatcgaccaaacgtcgccgtttatgattctccggatggt
gtggaggttcgaggacggtacgaccaaatcttcgccaagattttgacgagagaagctctt
agctttgtggctgagttacagagagagtttcgtggccatgtgaagtatgccatggagtgc
cggagagaggcaagacggcgttataactccggtgccgttcctgggtttgatccttccact
aagttcatcagagacggtgattggagctgtgcctccgtccctcctgccgttgctgaccgg
agagttgagatcaccggtccggtcgagaggaagatgatcatcaacgctcttaactccgga
gctaaagtctttatggctgatttcgaggacgctttgtctccaagctgggagaatctgatg
agagggcatgtgaacctgaaagatgcagtggatggatccattacgttccacgacaagtca
aggaacagagtttacaagctcaacgaccaaaccgctaagctttttgtccggccaagaggt
tggcatctcccggaggctcacatcctcatcgacggtgaacccgccactggatgtcttgtc
gattttggcctttacttcttccacaactacgccaaatttagacagactcaaggttccggt
ttcggtccattcttctatctccccaaaatggaacattctagggaagcaaagatatggaac
agtgtttttgagcgtgctgagaagatggctgggatagagagaggaagcattagagcaact
gtgcttatcgagaccctcccggctgtcttccagatgaatgagatactctatgaactacgt
gatcactcagtcggtttaaactgtggaagatgggattatatcttcagctatgtcaaaacc
ttccaagctcaccctgaccggctcttaccagaccgtgtcctagttggcatgggccagcat
ttcatgagaagttactctgatcttctcatccgtacttgtcataagcgcggtgtccacgcc
atgggtggcatggcggctcagattccgataagagatgacccaaaagcgaatgagatggca
ttggatctagtgaggaaagacaagctgagagaggtaagagcagggcatgatggaacatgg
gcggctcatccaggactcatcccaatctgcatggaagcattcactggtcacatgggaaaa
agtccaaaccaaatcaaatcagtgaagcgcgaggacgcagccgcaataacagaggaagat
ctgcttcaaataccgcgaggagtgcgtacactcgagggtttaaggctgaacacacgtgta
ggaattcaatacttagccgcatggttaacaggatcaggatctgtcccactctataaccta
atggaagatgctgctacggctgagataagccgtgtccagaattggcaatggattaggtat
ggagtggaacttgatggagacgggcttggagttcgagtgagtaaagagttgtttgggaga
gttgtcgaagaagagatggaaagaattgagaaagaagttgggaaagacaagtttaagaat
ggaatgtataaggaagcttgcaagatgtttacaaagcagtgtactgcacctgagcttgat
gattttcttacacttgctgtttataatcacattgtagctcactaccctatcaatgtctca
aggctctga

DBGET integrated database retrieval system