KEGG   Arabidopsis thaliana (thale cress): AT5G03860Help
Entry
AT5G03860         CDS       T00041                                 

Gene name
MLS
Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT5G03860 (MLS)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AT5G03860 (MLS)
   00630 Glyoxylate and dicarboxylate metabolism
    AT5G03860 (MLS)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AT5G03860 (MLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 562 aa AA seqDB search
MELETSVYRPNVAVYDSPDGVEVRGRYDQIFAKILTREALSFVAELQREFRGHVKYAMEC
RREARRRYNSGAVPGFDPSTKFIRDGDWSCASVPPAVADRRVEITGPVERKMIINALNSG
AKVFMADFEDALSPSWENLMRGHVNLKDAVDGSITFHDKSRNRVYKLNDQTAKLFVRPRG
WHLPEAHILIDGEPATGCLVDFGLYFFHNYAKFRQTQGSGFGPFFYLPKMEHSREAKIWN
SVFERAEKMAGIERGSIRATVLIETLPAVFQMNEILYELRDHSVGLNCGRWDYIFSYVKT
FQAHPDRLLPDRVLVGMGQHFMRSYSDLLIRTCHKRGVHAMGGMAAQIPIRDDPKANEMA
LDLVRKDKLREVRAGHDGTWAAHPGLIPICMEAFTGHMGKSPNQIKSVKREDAAAITEED
LLQIPRGVRTLEGLRLNTRVGIQYLAAWLTGSGSVPLYNLMEDAATAEISRVQNWQWIRY
GVELDGDGLGVRVSKELFGRVVEEEMERIEKEVGKDKFKNGMYKEACKMFTKQCTAPELD
DFLTLAVYNHIVAHYPINVSRL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggagctcgagacctcagtttatcgaccaaacgtcgccgtttatgattctccggatggt
gtggaggttcgaggacggtacgaccaaatcttcgccaagattttgacgagagaagctctt
agctttgtggctgagttacagagagagtttcgtggccatgtgaagtatgccatggagtgc
cggagagaggcaagacggcgttataactccggtgccgttcctgggtttgatccttccact
aagttcatcagagacggtgattggagctgtgcctccgtccctcctgccgttgctgaccgg
agagttgagatcaccggtccggtcgagaggaagatgatcatcaacgctcttaactccgga
gctaaagtctttatggctgatttcgaggacgctttgtctccaagctgggagaatctgatg
agagggcatgtgaacctgaaagatgcagtggatggatccattacgttccacgacaagtca
aggaacagagtttacaagctcaacgaccaaaccgctaagctttttgtccggccaagaggt
tggcatctcccggaggctcacatcctcatcgacggtgaacccgccactggatgtcttgtc
gattttggcctttacttcttccacaactacgccaaatttagacagactcaaggttccggt
ttcggtccattcttctatctccccaaaatggaacattctagggaagcaaagatatggaac
agtgtttttgagcgtgctgagaagatggctgggatagagagaggaagcattagagcaact
gtgcttatcgagaccctcccggctgtcttccagatgaatgagatactctatgaactacgt
gatcactcagtcggtttaaactgtggaagatgggattatatcttcagctatgtcaaaacc
ttccaagctcaccctgaccggctcttaccagaccgtgtcctagttggcatgggccagcat
ttcatgagaagttactctgatcttctcatccgtacttgtcataagcgcggtgtccacgcc
atgggtggcatggcggctcagattccgataagagatgacccaaaagcgaatgagatggca
ttggatctagtgaggaaagacaagctgagagaggtaagagcagggcatgatggaacatgg
gcggctcatccaggactcatcccaatctgcatggaagcattcactggtcacatgggaaaa
agtccaaaccaaatcaaatcagtgaagcgcgaggacgcagccgcaataacagaggaagat
ctgcttcaaataccgcgaggagtgcgtacactcgagggtttaaggctgaacacacgtgta
ggaattcaatacttagccgcatggttaacaggatcaggatctgtcccactctataaccta
atggaagatgctgctacggctgagataagccgtgtccagaattggcaatggattaggtat
ggagtggaacttgatggagacgggcttggagttcgagtgagtaaagagttgtttgggaga
gttgtcgaagaagagatggaaagaattgagaaagaagttgggaaagacaagtttaagaat
ggaatgtataaggaagcttgcaagatgtttacaaagcagtgtactgcacctgagcttgat
gattttcttacacttgctgtttataatcacattgtagctcactaccctatcaatgtctca
aggctctga

DBGET integrated database retrieval system