KEGG   Arabidopsis thaliana (thale cress): AT5G04640Help
Entry
AT5G04640         CDS       T00041                                 

Gene name
AGL99
Definition
(RefSeq) protein agamous-like 99
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 322 aa AA seqDB search
MGGVKRKISIELIEKKDSRAVAFSKRSRGLYSKASDLCLLSDAQIAIIATPVSSKSNVSF
YTFGHSSVDNVVAAFLTNQRPREGLGLDYWWEDERLSKSEDLEELRDAMDSMSKMLKDLK
DLQNQRDCEEDVKKKGVLHGTHQKQTFNPESCSVNFDGFNKNTEEFDLDEIFDYVSTAEA
LSMNLDMDDVSVVTTNQNPVSASETVEDRELVVHKNMDEDNIHVSDMDDKDTMLMISDKN
NVLPENLDEFDQELDLDQLLDFETNYESLLKSCEMEDYASMVTTKQNLCSNPEAVEDGGL
MIQKDLPEDNLCFSDYFSDLHC
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggggggcgtgaagagaaagatttctatagagctgatagagaagaaagattcaagagct
gttgctttctcaaaacgcagtaggggtctatatagcaaagcctctgatctttgtcttctc
tccgatgcacaaattgcgatcatagccactccggtctcttccaaatcaaacgtttctttc
tacacctttggccattcctctgttgataacgttgtagccgctttcctcacgaatcagcgt
cctcgggaaggtctagggttagactattggtgggaagatgagaggctttcaaaatcagag
gacctggaggaactgagagacgcaatggactcgatgtcgaagatgttgaaagatctgaag
gatttgcagaatcaacgagattgtgaggaggacgtgaagaagaagggtgttttacacgga
actcatcaaaagcaaacctttaatcctgaatcatgttctgtgaatttcgatgggtttaac
aagaacactgaagaatttgatcttgatgaaatatttgattatgtgtcaacagctgaagct
ctatcgatgaacttggacatggacgatgtctctgtggtgaccacgaatcaaaaccccgtc
tctgcttctgaaactgttgaagatagagaattggttgttcacaaaaatatggatgaggac
aatatccacgtgtctgatatggacgacaaggatacgatgctaatgatttctgacaagaac
aatgttttacctgaaaacttggatgaattcgatcaagagctagatcttgatcagctactt
gattttgagacaaactatgaaagccttttgaagagttgtgagatggaggattatgcctcg
atggtgactacaaagcaaaatctgtgctcaaatcctgaagctgttgaagatggaggatta
atgattcaaaaagatttaccggaggataatctctgcttttctgattatttcagtgactta
cattgctga

DBGET integrated database retrieval system