KEGG   Arabidopsis thaliana (thale cress): AT5G04940Help
Entry
AT5G04940         CDS       T00041                                 

Gene name
SUVH1
Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1
  KO
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AT5G04940 (SUVH1)
Enzymes [BR:ath01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AT5G04940 (SUVH1)
Chromosome [BR:ath03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     AT5G04940 (SUVH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 670 aa AA seqDB search
MERNGGHYTDKTRVLDIKPLRTLRPVFPSGNQAPPFVCAPPFGPFPPGFSSFYPFSSSQA
NQHTPDLNQAQYPPQHQQPQNPPPVYQQQPPQHASEPSLVTPLRSFRSPDVSNGNAELEG
STVKRRIPKKRPISRPENMNFESGINVADRENGNRELVLSVLMRFDALRRRFAQLEDAKE
AVSGIIKRPDLKSGSTCMGRGVRTNTKKRPGIVPGVEIGDVFFFRFEMCLVGLHSPSMAG
IDYLVVKGETEEEPIATSIVSSGYYDNDEGNPDVLIYTGQGGNADKDKQSSDQKLERGNL
ALEKSLRRDSAVRVIRGLKEASHNAKIYIYDGLYEIKESWVEKGKSGHNTFKYKLVRAPG
QPPAFASWTAIQKWKTGVPSRQGLILPDMTSGVESIPVSLVNEVDTDNGPAYFTYSTTVK
YSESFKLMQPSFGCDCANLCKPGNLDCHCIRKNGGDFPYTGNGILVSRKPMIYECSPSCP
CSTCKNKVTQMGVKVRLEVFKTANRGWGLRSWDAIRAGSFICIYVGEAKDKSKVQQTMAN
DDYTFDTTNVYNPFKWNYEPGLADEDACEEMSEESEIPLPLIISAKNVGNVARFMNHSCS
PNVFWQPVSYENNSQLFVHVAFFAISHIPPMTELTYDYGVSRPSGTQNGNPLYGKRKCFC
GSAYCRGSFG
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaatggtggtcactacactgataagacgagagtgttggatattaaaccattg
cgtactctaagacctgtgtttcccagtggaaatcaagctccgccttttgtgtgtgctcct
ccttttggaccatttcctcctgggttctcatcgttttatccgtttagttcgtctcaagcg
aatcagcacacaccagatcttaaccaagctcagtatccaccgcaacatcagcagcctcag
aatccaccaccggtatatcagcagcagcctcctcagcatgcatctgagccttcgttggtt
actcctttaaggtcatttagatctcctgatgtgtctaatggcaacgcggaacttgagggg
tcaactgtgaaaagaaggatccctaaaaagcgtcccatttctcggcctgagaatatgaat
ttcgagagtgggattaatgtggctgatagagagaatggcaatagggagttggtgttgagt
gttcttatgcggtttgatgcgttaagaagaaggtttgcacaacttgaggatgctaaggaa
gcagttagtgggattatcaaacgccctgatttgaaatcaggatctacttgtatgggcaga
ggggtgcggacaaacaccaaaaaaagacctggtattgttcctggtgttgagattggggac
gtattcttcttcaggtttgagatgtgtttggtggggttgcattctccatcaatggctggg
attgactatctggttgtcaagggagaaacggaagaagaacctatcgccactagcattgtc
tcatctggatattatgataatgacgaaggtaatcctgatgttttgatttatactggtcag
ggtggtaatgctgataaagataagcaatcttctgaccaaaagctcgaaaggggtaatctt
gccttggagaagagcttgcgtagagatagtgcagttagggtaataaggggcttgaaagag
gcttctcataatgctaagatctatatttatgatggactctatgagattaaagagtcatgg
gtagagaaaggaaaatctggacacaacaccttcaagtataaactagttagagctcctggt
caaccgcctgcatttgcttcatggactgcaatccagaaatggaagacgggtgtgccttca
aggcaaggactcattcttcccgatatgacttccggggttgaaagcatacctgtttcactt
gttaacgaagttgataccgacaatgggcctgcttatttcacctactccacaactgtgaaa
tactcagagtcgtttaagctgatgcagccttcttttggatgtgattgtgccaacttatgc
aaaccagggaacttggattgtcactgcataaggaaaaatggaggtgacttcccctacacc
ggtaatggaattctagttagccgaaagcctatgatatatgaatgcagtccatcttgcccg
tgctcgacttgcaaaaacaaggtgactcaaatgggagtaaaagtgaggctggaagttttc
aagacagcgaatagaggatggggattgcggtcatgggatgctattcgtgctggttctttt
atatgtatctatgtaggtgaggccaaagacaaatcaaaggtgcagcaaactatggctaat
gatgattatacttttgatacaaccaatgtgtataaccctttcaagtggaactacgaacct
ggcttagcagacgaagatgcttgtgaagagatgtctgaagaatctgaaatcccgctgcca
ctgataatcagtgctaagaatgttgggaacgttgcccgattcatgaatcatagttgctca
cctaatgttttctggcagccggttagttatgaaaataacagtcaactctttgtgcatgtg
gccttctttgccatttctcacatccctccaatgactgagttaacttacgactatggagta
tctagaccaagtgggactcaaaatggcaatcctttatatggcaaaaggaaatgcttctgt
ggatcagcgtattgccgtggctcatttggatga

DBGET integrated database retrieval system