KEGG   Arabidopsis thaliana (thale cress): AT5G05130Help
Entry
AT5G05130         CDS       T00041                                 

Definition
(RefSeq) DNA/RNA helicase
  KO
K15711  
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A3 [EC:3.6.4.- 2.3.2.27]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     AT5G05130
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     AT5G05130
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    AT5G05130
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    AT5G05130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 862 aa AA seqDB search
MAQFLRRFSSSPMANEDEFQSPVEPSQQQSQDCVSESYLIGFVIANIVGLKYYSGRINGR
EMVGLVREPLNVYDNNAIRVLNTRSEQVGHIERTVAAVLAPMIDSHTIVVEGIVPNTRSN
SNRYRIPCQIHVFAKLEASSTVKSTISRGGLVLISESDTSFGLSEAVVVKEQMGNGDKRS
VDKIFKLVDENVKLMGKLVAAEPPREVIKSELFAHQKEGLGWLLHREKSGELPPFWEEKD
GEFLNTLTNYRSDKRPDPLRGGVFADDMGLGKTLTLLSLIAFDRYGNASTSTPTEEPLDG
EGDKIEKKGKKRGRGKSSESVTRKKLKTDDVVGMNVSQKTTLIVCPPSVISAWITQLEEH
TVPGILKVYMYHGGERTDDVNELMKYDIVLTTYGTLAVEESWEDSPVKKMEWLRIILDEA
HTIKNANAQQSRVVCKLKASRRWAVTGTPIQNGSFDLYSLMAFLRFEPFSIKSYWQSLIQ
RPLGQGNKKGLSRLQVLMATISLRRTKEKSLIGLPPKTVETCYVELSPEERQLYDHMEGE
AKGVVQNLINNGSLMRNYSTVLSIILRLRQLCDDMSLCPPELRSFTTSTSVEDVTDKPEL
LQKLVAALQDGEDFDCPICISPPTNIIITRCAHIFCRACILQTLQRSKPLCPLCRGSLTQ
SDLYNAPPPPPDSSNTDGEDAKSSTKSSKVSALLSLLMASRQENPNTKSVVFSQFRKMLL
LLETPLKAAGFTILRLDGAMTVKKRTQVIGEFGNPELTGPVVLLASLKASGTGINLTAAS
RVYLFDPWWNPAVEEQAMDRIHRIGQKQEVKMIRMIARNSIEERVLELQQKKKNLANEAF
KRRQKKDEREVNVEDVVALMSL
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtttcttcgacgcttctcttcctctcccatggcgaacgaagacgaattccaa
tctccggtggaaccatcacagcagcaatctcaggactgtgtttcggagtcttatctgata
gggtttgttatcgcgaacatagtagggttaaagtactattccggccgaatcaacggtcga
gagatggtgggtctggttcgagaacccttgaacgtatatgacaataatgcaatcagagta
ctcaacacgcgatctgagcaagtgggtcacatcgagcgtacagtagcagccgttctcgcg
ccgatgattgattctcacacgatcgtcgtcgagggtattgtacccaatactcgttctaac
tccaataggtacagaatcccttgtcaaattcatgtatttgcaaagttagaagcgtcctct
actgtgaaatcgacgatttctagaggtgggttagtattgatttcggagtcagatacatcg
tttgggttatctgaggctgttgtggttaaggaacagatgggaaatggagataagaggagt
gttgataagatttttaaacttgttgatgagaatgtgaagttaatggggaaattggtagcg
gctgagccacctagggaagtgataaagtctgaactttttgctcatcagaaggaaggatta
ggctggttactccatagagagaaatctggagaattgcctccgttttgggaggagaaagat
ggagaatttttgaatactttgacgaattaccgctcggataagcggcctgatcctttgcgt
ggaggggtgtttgctgatgatatggggttgggtaagacccttactttgctttccctgata
gcttttgatagatatggcaatgcatccaccagtacgccaaccgaagagcctttggatggt
gaaggagacaagattgaaaagaagggtaaaaagagaggaagaggcaagagcagtgaaagt
gtaactcgaaagaagcttaaaactgatgatgttgttggcatgaatgtgtctcaaaagaca
acgttgatcgtttgtccaccttctgtgatttcagcatggataacacagttagaggagcat
actgtaccgggaatcttgaaggtgtatatgtatcatggtggcgaaaggacagacgatgtt
aatgagcttatgaagtatgacatagtgttgactacttacggcactttagctgttgaggaa
tcgtgggaagattctcctgtaaagaaaatggagtggctgagaataattcttgatgaggca
cacaccattaagaatgcaaatgctcaacagagccgagtagtttgtaagttgaaggcttcc
cgcagatgggctgtcacaggaactcctattcagaatggttcatttgatttgtactctttg
atggcctttctccggtttgagccattttcgattaagagttattggcaaagtttgatacaa
cgcccgcttggccaagggaataaaaagggtctttcacgtctgcaggttttaatggcgaca
atttcgttaagaagaacaaaagaaaagagtttgattggtttaccgcctaagactgttgaa
acttgttatgttgagctttctccggaagaacgtcagttatatgatcacatggaaggagaa
gcgaaaggtgttgtgcagaatcttataaataatggaagcttgatgcgcaactactcaaca
gttttgagtataatcttacggcttagacagctttgcgatgacatgtctctatgccctcca
gaattaagatcttttaccacttctacatctgtagaagatgtgactgataagccagagcta
ctgcaaaagctggttgcagcattgcaagatggcgaagattttgactgtccaatctgcatt
tcgccaccaacaaacatcatcatcactcgatgtgcccacatcttttgcagggcttgtatc
cttcaaactcttcaaagaagtaaaccattgtgccctctttgccgtggctcccttacccaa
tctgatctctacaatgctccgcctcctcctccggattcttccaataccgatggagaagac
gctaaatcttcaaccaaatcctcaaaggtctcagctttactatccctgctcatggcatcg
agacaagaaaaccccaacacaaagtctgttgtgttctctcaattcaggaagatgctgctt
ttactagaaactccactaaaagctgcgggtttcaccatcttgcgcttggatggagcaatg
actgtgaagaaacggacccaagtcattggagaatttgggaatccagagttaaccggacct
gtggtgttgcttgcgagcctcaaggcctctggtactggcataaacctaactgcagcctca
agggtttacttgtttgacccgtggtggaaccctgcagttgaagaacaggccatggacagg
attcataggatcgggcagaaacaagaggttaaaatgataaggatgattgcgagaaacagt
atcgaagagagggtccttgagcttcagcagaagaagaagaatctagcaaacgaagctttt
aaaagaaggcaaaagaaagatgaaagagaggttaacgttgaagacgtggttgctctcatg
tctctctga

DBGET integrated database retrieval system