KEGG   Arabidopsis thaliana (thale cress): AT5G05410Help
Entry
AT5G05410         CDS       T00041                                 

Gene name
DREB2A
Definition
(RefSeq) dehydration-responsive element-binding protein 2A
  KO
K09286  
EREBP-like factor
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Other transcription factors
   EREBP
    AT5G05410 (DREB2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 335 aa AA seqDB search
MAVYDQSGDRNRTQIDTSRKRKSRSRGDGTTVAERLKRWKEYNETVEEVSTKKRKVPAKG
SKKGCMKGKGGPENSRCSFRGVRQRIWGKWVAEIREPNRGSRLWLGTFPTAQEAASAYDE
AAKAMYGPLARLNFPRSDASEVTSTSSQSEVCTVETPGCVHVKTEDPDCESKPFSGGVEP
MYCLENGAEEMKRGVKADKHWLSEFEHNYWSDILKEKEKQKEQGIVETCQQQQQDSLSVA
DYGWPNDVDQSHLDSSDMFDVDELLRDLNGDDVFAGLNQDRYPGNSVANGSYRPESQQSG
FDPLQSLNYGIPPFQLEGKDGNGFFDDLSYLDLEN
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcagtttatgatcagagtggagatagaaacagaacacaaattgatacatcgaggaaa
aggaaatctagaagtagaggtgacggtactactgtggctgagagattaaagagatggaaa
gagtataacgagaccgtagaagaagtttctaccaagaagaggaaagtacctgcgaaaggg
tcgaagaagggttgtatgaaaggtaaaggaggaccagagaatagccgatgtagtttcaga
ggagttaggcaaaggatttggggtaaatgggttgctgagatcagagagcctaatcgaggt
agcaggctttggcttggtactttccctactgctcaagaagctgcttctgcttatgatgag
gctgctaaagctatgtatggtcctttggctcgtcttaatttccctcggtctgatgcgtct
gaggttacgagtacctcaagtcagtctgaggtgtgtactgttgagactcctggttgtgtt
catgtgaaaacagaggatccagattgtgaatctaaacccttctccggtggagtggagccg
atgtattgtctggagaatggtgcggaagagatgaagagaggtgttaaagcggataagcat
tggctgagcgagtttgaacataactattggagtgatattctgaaagagaaagagaaacag
aaggagcaagggattgtagaaacctgtcagcaacaacagcaggattcgctatctgttgca
gactatggttggcccaatgatgtggatcagagtcacttggattcttcagacatgtttgat
gtcgatgagcttctacgtgacctaaatggcgacgatgtgtttgcaggcttaaatcaggac
cggtacccggggaacagtgttgccaacggttcatacaggcccgagagtcaacaaagtggt
tttgatccgctacaaagcctcaactacggaatacctccgtttcagctcgagggaaaggat
ggtaatggattcttcgacgacttgagttacttggatctggagaactaa

DBGET integrated database retrieval system