KEGG   Arabidopsis thaliana (thale cress): AT5G06510Help
Entry
AT5G06510         CDS       T00041                                 

Gene name
NF-YA10
Definition
(RefSeq) nuclear factor Y, subunit A10
  KO
K08064  nuclear transcription factor Y, alpha
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Transcription factors [BR:ath03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    AT5G06510 (NF-YA10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBFB_NFYA
Motif
Other DBs
NCBI-GeneID: 830539
NCBI-ProteinID: NP_001330575
MIPS: AT5G06510.1
TAIR: AT5G06510
Araport: AT5G06510
UniProt: Q8LFU0 A0A178URE3
Position
5
AA seq 269 aa AA seqDB search
MQTEELLSPPQTPWWNAFGSQPLTTESLSGEASDSFTGVKAVTTEAEQGVVDKQTSTTLF
TFSPGGEKSSRDVPKPHVAFAMQSACFEFGFAQPMMYTKHPHVEQYYGVVSAYGSQRSSG
RVMIPLKMETEEDGTIYVNSKQYHGIIRRRQSRAKAEKLSRCRKPYMHHSRHLHAMRRPR
GSGGRFLNTKTADAAKQSKPSNSQSSEVFHPENETINSSREANESNLSDSAVTSMDYFLS
SSAYSPGGMVMPIKWNAAAMDIGCCKLNI
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactgaggagcttttgtcgccaccacagactccttggtggaatgcttttggatct
cagccgttgactacagagagcctttccggcgaagcttctgattcattcaccggagttaag
gcagttactacggaggcagaacaaggtgtggtggataaacaaacttctacaactctcttc
actttctcacctggtggtgaaaagagttcaagagatgtgccaaagcctcatgttgctttc
gcgatgcaatcagcttgcttcgagtttggatttgctcagccaatgatgtacacaaagcat
cctcatgttgaacaatactatggagttgtttcagcatacggatctcagaggtcttcgggc
cgagtaatgattccactgaagatggagacagaagaagatggtaccatctatgtgaactca
aagcagtaccatggaattatcaggcgacgccagtcccgagcaaaggctgaaaaactgagt
agatgccgtaagccatatatgcatcactcacgccatctccatgctatgcgccgtcctaga
ggatctggcgggcgtttcttgaacaccaagacagctgatgcggctaagcagtctaagccg
agtaattctcagagttctgaagtctttcatccggaaaatgagaccataaactcatcgagg
gaagcaaatgagtcaaatctctcggattctgcagttacaagtatggattactttctaagt
tcgtcggcttattctcctggtggcatggtcatgcctatcaagtggaatgcagcagcaatg
gatattggctgctgcaaacttaatatatga

DBGET integrated database retrieval system