KEGG   Arabidopsis thaliana (thale cress): AT5G06540Help
Entry
AT5G06540         CDS       T00041                                 

Definition
(RefSeq) pentatricopeptide repeat-containing protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 622 aa AA seqDB search
MSNIVLNTLRFKHPKLALLQSCSSFSDLKIIHGFLLRTHLISDVFVASRLLALCVDDSTF
NKPTNLLGYAYGIFSQIQNPNLFVFNLLIRCFSTGAEPSKAFGFYTQMLKSRIWPDNITF
PFLIKASSEMECVLVGEQTHSQIVRFGFQNDVYVENSLVHMYANCGFIAAAGRIFGQMGF
RDVVSWTSMVAGYCKCGMVENAREMFDEMPHRNLFTWSIMINGYAKNNCFEKAIDLFEFM
KREGVVANETVMVSVISSCAHLGALEFGERAYEYVVKSHMTVNLILGTALVDMFWRCGDI
EKAIHVFEGLPETDSLSWSSIIKGLAVHGHAHKAMHYFSQMISLGFIPRDVTFTAVLSAC
SHGGLVEKGLEIYENMKKDHGIEPRLEHYGCIVDMLGRAGKLAEAENFILKMHVKPNAPI
LGALLGACKIYKNTEVAERVGNMLIKVKPEHSGYYVLLSNIYACAGQWDKIESLRDMMKE
KLVKKPPGWSLIEIDGKINKFTMGDDQKHPEMGKIRRKWEEILGKIRLIGYKGNTGDAFF
DVDEEEKESSIHMHSEKLAIAYGMMKTKPGTTIRIVKNLRVCEDCHTVTKLISEVYGREL
IVRDRNRFHHFRNGVCSCRDYW
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacattgtgctcaacacacttcgattcaaacacccgaagcttgccttgctccaa
tcctgctcttccttttccgacctcaagatcatacatggctttctcttacgaacccatctc
atctccgacgtcttcgttgccagtcgtctcctcgctctctgcgttgacgactccaccttc
aacaaaccaaccaatctcttgggatatgcatacggaatcttctctcagattcaaaaccct
aatcttttcgtcttcaatctactcattcgctgcttctccactggtgcagagcctagtaag
gcttttgggttctatacccagatgttgaaatctcggatttggccagataacatcacgttt
ccgtttctgattaaggcgtctagtgagatggagtgtgttctagtgggagagcaaacgcat
tcacagattgttagattcggatttcagaatgatgtttatgtagagaattcgcttgttcat
atgtacgctaattgtgggttcatcgctgctgctggtagaatctttgggcaaatggggttt
cgagatgttgtttcatggacttctatggtggctgggtattgtaaatgcgggatggttgag
aatgcacgagagatgttcgatgaaatgcctcacagaaatttgtttacttggagtattatg
attaatgggtatgcgaagaacaactgttttgagaaagccattgacttgtttgaattcatg
aaaagggaaggagttgtcgcgaatgagacggttatggtgagtgtgatttcgtcttgtgct
catttgggtgcacttgagtttggagaaagagcatatgagtatgtggttaagagtcacatg
actgtgaatcttattcttgggacagctcttgtggatatgttttggaggtgtggggatatc
gagaaagcaattcatgtatttgagggattgcctgagacggatagcttgagctggagttca
ataatcaaaggtcttgcagtgcatgggcatgctcacaaggcaatgcattacttctcccaa
atgattagtttagggtttattccaagggatgttacattcacagcggttctttcagcttgc
agccacggtggattagttgaaaaagggttagagatatatgagaacatgaaaaaggatcat
gggatcgagcctagactcgagcattatggttgcattgttgatatgcttggtcgtgctggg
aaattagccgaagcggagaactttatccttaaaatgcatgtgaagccaaacgctcctata
ttgggagcattgcttggagcatgtaagatttataagaacaccgaggttgcagagagagta
ggaaacatgttgataaaggtgaaaccagaacatagcggttactatgtcttactgtcaaat
atatacgcgtgtgcaggacaatgggataagatagagagcttgagagacatgatgaaggag
aagcttgttaagaaaccaccagggtggagcttaatagagattgatgggaaaataaacaag
ttcacaatgggagatgatcagaagcatcctgaaatgggtaagatcagaaggaagtgggaa
gagatcttggggaagataagattgatagggtataaagggaacacaggtgatgcgtttttc
gatgtagacgaggaggagaaggagagttcgattcatatgcatagtgagaaacttgcaatt
gcatatggtatgatgaagactaagcctggtacaaccattaggatagtgaagaacttgagg
gtatgtgaagattgtcatacagtaacaaagcttatctctgaggtttatggtagagagtta
attgtaagagaccgcaacagatttcatcattttagaaatggagtatgttcctgcagagat
tattggtga

DBGET integrated database retrieval system