KEGG   Arabidopsis thaliana (thale cress): AT5G06600Help
Entry
AT5G06600         CDS       T00041                                 

Gene name
UBP12
Definition
ubiquitin carboxyl-terminal hydrolase 12
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AT5G06600 (UBP12)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AT5G06600 (UBP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 985 aa AA seqDB search
MTMMTPPPVDQPEDEEMLVPNSDLVDGPAQPMEVTQPETAASTVENQPAEDPPTLKFTWT
IPNFSRQNTRKHYSDVFVVGGYKWRILIFPKGNNVDHLSMYLDVSDAASLPYGWSRYAQF
SLAVVNQIHTRYTVRKETQHQFNARESDWGFTSFMPLSELYDPSRGYLVNDTVLVEAEVA
VRKVLDYWSYDSKKETGFVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDAPTA
SIPLALQSLFYKLQYNDTSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMKGT
VVEGTIQQLFEGHHMNYIECINVDFKSTRKESFYDLQLDVKGCKDVYASFDKYVEVERLE
GDNKYHAEGHGLQDAKKGVLFIDFPPVLQLQLKRFEYDFMRDTMVKINDRYEFPLELDLD
REDGKYLSPDADRSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSDQWYKFDDERVTKED
LKRALEEQYGGEEELPQTNPGFNNNPPFKFTKYSNAYMLVYIRESDKDKIICNVDEKDIA
EHLRVRLKKEQEEKEDKRRYKAQAHLYTIIKVARDEDLKEQIGKDIYFDLVDHDKVRSFR
IQKQTPFQQFKEEVAKEFGVPVQLQRFWIWAKRQNHTYRPNRPLTPQEELQPVGQIREAS
NKANTAELKLFLEVEHLDLRPIPPPEKSKEDILLFFKLYDPEKAVLSYAGRLMVKSSSKP
MDITGKLNEMVGFAPDEEIELFEEIKFEPCVMCEHLDKKTSFRLCQIEDGDIICFQKPLV
NKEIECLYPAVPSFLEYVQNRQLVRFRALEKPKEDEFVLELSKQHTYDDVVEKVAEKLGL
DDPSKLRLTSHNCYSQQPKPQPIKYRGVDHLSDMLVHYNQTSDILYYEVLDIPLPELQGL
KTLKVAFHHATKEEVVIHNIRLPKQSTVGDVINELKTKVELSHPDAELRLLEVFYHKIYK
IFPSTERIENINDQYWTLRAEEVYY
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgactatgatgactccgcctcccgttgatcagccagaagatgaggagatgcttgtgccg
aattcagatttggtcgacggtcctgctcagcccatggaagttacccaacccgagactgct
gcgagtactgtggagaaccagccagctgaggatcctcctactctgaaattcacgtggact
atccctaatttctctaggcaaaacaccaggaagcattactccgatgtatttgtcgttgga
ggttacaaatggcgcatattaattttcccgaaagggaacaatgttgatcatttgtccatg
tacttggatgtttctgatgctgcgagtttgccgtacggttggagcagatatgctcagttc
agtctggctgtagtcaatcaaatccacaccagatataccgttagaaaagagacgcaacat
caattcaatgctagagaaagcgattggggatttacatcattcatgccacttagcgaactt
tatgatcctagtagaggatatttagtgaatgatactgttttggttgaagctgaagtcgct
gtacgtaaggttcttgattactggtcatatgactctaaaaaagagactggttttgttgga
ctcaagaaccaaggtgcaacatgctacatgaattctctcctacagacactataccacata
ccttacttcagaaaggctgtataccacatgccaacaactgagaatgatgcacccacagca
agtataccgttggctctccaaagtttgttttacaagctccaatacaatgacactagtgtt
gcaacaaaagagctgacaaagtcgtttggttgggatacatatgattccttcatgcagcat
gatgtgcaagaactcaatcgggttctctgcgaaaagcttgaggacaaaatgaagggaact
gttgtggagggaacaatacaacaactttttgagggccaccatatgaattacattgagtgc
ataaatgtagattttaaatctacacggaaagaatcattttacgaccttcagctggatgtt
aaaggctgcaaggatgtttatgcttcttttgacaagtatgttgaagttgaacgtcttgaa
ggagacaacaaatatcatgcagaaggacatggtttacaggatgcaaaaaaaggtgttctt
ttcattgactttccaccggttcttcaactccagctcaagaggtttgaatatgactttatg
agggacaccatggtgaagataaatgatcggtatgagtttccgcttgaactggatcttgat
agagaagatggaaagtatctgtcgcctgatgctgacaggagtgtccgcaacctttatact
cttcacagtgttttagttcatagtggaggagtacatggtgggcactattatgcttttata
aggcctacgctctcagatcagtggtataaatttgatgatgaacgagtaaccaaggaagat
ttgaaaagggctttggaggagcaatatggtggtgaagaagagctaccacagactaatcct
ggtttcaataataaccctcctttcaaattcacaaagtactcgaatgcttacatgcttgta
tatatccgagaaagtgacaaagataaaataatctgcaacgttgatgagaaagacatagca
gaacatttaagggtgaggctaaagaaagagcaagaagaaaaggaagataaaagaagatac
aaggcacaagctcacttatataccataattaaggttgcaagagatgaagaccttaaggaa
caaattgggaaggatatatattttgatcttgtggatcatgacaaagttcgcagtttccgt
atccagaaacagacaccatttcaacagtttaaggaggaggtagcaaaagaatttggtgta
cctgttcagttacagaggttctggatttgggcaaagagacaaaaccatacctatcgtccc
aatcgcccccttacgcctcaagaggaattacaaccggttggacaaataagggaagcatct
aataaggcaaacactgcagaactcaagctttttttggaagtagagcacctggatttacgt
cctattcctcctcctgaaaaatcaaaagaagatattcttcttttcttcaagctttatgac
cccgagaaggcagtattaagctatgctggcaggctgatggtgaaaagttccagtaagcct
atggatataactggaaaactgaatgaaatggttggctttgctcctgatgaagaaatagaa
ctttttgaggaaatcaagtttgaaccttgtgttatgtgcgaacacttggataagaaaact
tcattcagattgtgtcaaattgaagatggagatatcatttgctttcagaaacctcttgtt
aacaaggagattgaatgcctctacccagctgtgccttcgtttcttgaatatgtccagaat
agacagctggtccggtttcgtgctctggaaaaacctaaagaagatgagtttgttctggag
ttgtcgaagcagcacacttatgacgatgttgtggagaaagtggctgagaagcttggtctt
gacgatccatccaaacttaggcttacatctcacaattgctattcccagcaacccaagcct
cagcctatcaagtaccgtggagtagaccatttgtcagatatgttagttcattacaatcag
acgtctgacattttgtattatgaagttctggacatccctcttccagaattacaaggtctt
aaaaccttaaaagttgctttccatcatgccacgaaggaagaagtggtaatccacaatatc
agactacctaaacaaagcacggtcggagatgttattaatgaacttaaaacaaaggtggag
ctttcgcatccagatgcagaactgagattgctcgaggtgttttaccacaagatctacaag
attttcccatcaactgaaagaattgagaatataaatgaccagtactggactttacgagct
gaggaggtatattactag

DBGET integrated database retrieval system