KEGG   Arabidopsis thaliana (thale cress): AT5G08370Help
Entry
AT5G08370         CDS       T00041                                 

Gene name
AGAL2
Definition
alpha-galactosidase 2
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ath00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ath00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ath00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:ath00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 370 aa AA seqDB search
MSRMLMNNGLALSPQMGWNSWNHFQCNINETLIKQTADAMVSSGLSAIGYKYINIDDCWG
ELKRDSQGSLVAKASTFPSGIKALSDYVHSKGLKLGIYSDAGTLTCSQTMPGSLGHEEQD
AKTFASWGIDYLKYDNCENTGTSPRERYPKMSKALLNSGRSIFFSLCEWGQEDPATWAGD
IGNSWRTTGDIQDNWKSMTLIADQNDRWASYARPGSWNDPDMLEVGNGGMTKEEYMSHFS
IWALAKAPLLIGCDLRSMDKVTFELLSNKEVIAVNQDKLGIQGKKVKKEGDLEVWAGPLS
KKRVAVILWNRGSASANITARWAEIGLNSSDIVNARDLWEHSTYSCVKKQLSALVEPHAC
KMYTLTRRKA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaatgttgatgaacaatggacttgctctctctcctcaaatgggatggaacagc
tggaatcattttcagtgtaatatcaatgaaacccttatcaaacaaaccgctgatgcaatg
gtttcaagtggtctttctgcaataggttacaagtatatcaacatagatgattgttggggt
gaactcaagagagattctcaggggagtttggttgcaaaagcatcaacatttccttcagga
atcaaagctttatcagattatgttcatagcaaagggctaaaacttgggatatactctgat
gccgggactcttacctgcagccaaaccatgccgggatcactcgggcatgaagaacaagat
gccaagacatttgcctcatgggggattgattacctcaagtatgataactgcgaaaataca
gggacaagtccaagagaaagataccctaagatgagtaaagcgctgttaaattcaggaaga
tccatattcttctctctgtgcgaatggggacaagaggatccagcaacttgggcaggagat
attggcaacagttggagaacaacaggagatatccaagataattggaaaagcatgacattg
atagcggatcagaatgatcgatgggcatcttatgcaagaccaggatcgtggaacgatcca
gacatgcttgaagtgggaaatggaggcatgactaaggaagaatacatgtcgcatttcagc
atctgggcattggcaaaagctcctctgctgatcggctgcgatcttagatcgatggacaaa
gttacatttgaattgcttagcaacaaagaggtgattgctgttaatcaagacaaacttggg
atccagggaaagaaagtaaagaaagaaggtgatcttgaggtatgggcaggtccactaagc
aagaaacgagtagcggtcatcctatggaacagaggatcagcatctgcaaacatcacagct
cgatgggctgagattggcctcaattcatcagatattgttaatgctcgtgacttatgggag
cattcgacatattcatgtgttaaaaagcagctatctgccctagtggagcctcatgcctgc
aaaatgtatactcttacaagacgcaaggcataa

DBGET integrated database retrieval system