KEGG   Arabidopsis thaliana (thale cress): AT5G08380Help
Entry
AT5G08380         CDS       T00041                                 

Gene name
AGAL1
Definition
(RefSeq) alpha-galactosidase 1
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00052  Galactose metabolism
ath00561  Glycerolipid metabolism
ath00600  Sphingolipid metabolism
ath00603  Glycosphingolipid biosynthesis - globo and isoglobo series
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AT5G08380 (AGAL1)
  Lipid metabolism
   00561 Glycerolipid metabolism
    AT5G08380 (AGAL1)
   00600 Sphingolipid metabolism
    AT5G08380 (AGAL1)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    AT5G08380 (AGAL1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AT5G08380 (AGAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase Melibiase_2_C Raffinose_syn
Motif
Other DBs
NCBI-GeneID: 830736
NCBI-ProteinID: NP_196455
MIPS: AT5G08380.1
TAIR: AT5G08380
Araport: AT5G08380
UniProt: Q9FT97
Position
5
AA seq 410 aa AA seqDB search
MSRRAMVIKMPILMILISSMVMTMVESSRSVNNGHDDSEILRRHLLTNGLGVTPPMGWNS
WNHFSCNIDEKMIKETADALVTTGLSKLGYNYVNIDDCWAEISRDSKGSLVPKKSTFPSG
IKAVADYVHSKGLKLGIYSDAGYFTCSKTMPGSLGYEEHDAKTFAEWGIDYLKYDNCNSD
GSKPTVRYPVMTRALMKSGRPIFHSLCEWGDMHPALWGSPVGNSWRTTNDIKDTWLSMIS
IADMNEVYAEHARPGGWNDPDMLEVGNGGMTKDEYIVHFSIWAISKAPLLLGCDIRNMTK
ETMEIVANKEVIAINQDPHGVQAKKVRMEGDLEVWAGPLSGYRVALLLLNRGPSRTSITA
LWEDIEIPANSIVEARDLWEHQTLKQKFVGNLTATVDSHACKLYVLKPVA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagacgagcaatggtgataaagatgccaatacttatgatactgatttcatcaatg
gtgatgacgatggtcgagtcttcgagatcagttaataatggtcatgacgattctgagatc
ttacgaagacacttgctcactaatggcctcggagtcactcctcccatggggtggaatagc
tggaaccattttagctgcaacatagatgaaaaaatgatcaaagaaactgctgatgctttg
gttaccactggcctctctaagcttggctacaactatgttaacatcgatgattgctgggct
gaaatttctcgtgacagcaagggaagtctggtgccaaagaagtcaactttcccttctgga
attaaagcggttgcggattatgttcacagtaaaggccttaagcttgggatttactcagat
gccgggtatttcacttgcagtaaaaccatgccaggttctttaggctacgaggagcatgat
gccaagacatttgcagaatggggaattgattacttgaagtatgacaactgcaacagcgat
ggctctaaacctactgtcaggtatccagtgatgactcgagctctgatgaaatctggccgc
cccatctttcactcattgtgtgaatggggagatatgcatccagctctatggggatctcca
gtaggcaacagttggagaaccactaatgacattaaagatacttggcttagtatgatctca
atagcagacatgaatgaagtctacgctgagcatgcaagacctggtggctggaacgacccg
gatatgcttgaagtgggaaatggagggatgacaaaagacgagtacatagtccatttcagc
atatgggcaatctcaaaggctcctcttctacttggttgtgacataagaaacatgaccaaa
gaaacaatggagattgtcgccaacaaggaagtcattgctattaatcaagatccacatggt
gttcaggccaagaaagttagaatggaaggcgatctcgaggtttgggcaggaccattgtca
ggttacagagtagctttgcttctattgaaccgtggaccatcgcgaacttcgattactgct
ctttgggaggatattgagatccctgcaaatagcatcgttgaagccagagatctatgggag
caccagacattgaagcaaaagtttgtggggaacttgacagcaacagtggattctcatgcg
tgtaagttgtatgttctcaaacctgttgcctga

DBGET integrated database retrieval system