KEGG   Arabidopsis thaliana (thale cress): AT5G09290Help
Entry
AT5G09290         CDS       T00041                                 

Definition
Inositol monophosphatase family protein
Orthology
K15422  
3'(2'), 5'-bisphosphate nucleotidase / inositol polyphosphate 1-phosphatase [EC:3.1.3.7 3.1.3.57]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ath00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ath00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ath04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 345 aa AA seqDB search
MPYEKELAAAKKAVSLAARLSQEVQKSLLQSDVRSKSDKSPVTAADYGSQAVISHVLERE
LHPEPLYLVAEENAEDLHKNGAEEFLESITKLVNNALASDDSYANSSLSMDDVRKAIDHG
RSQGGSSGRHWILDPVDGTRGFVKGEEYAVALALLVEGKVVLGVMACPKLENHKSSSSGC
LFFATVGEGAYVQSLEGDSHPPQKVQVSNIENPEEATFVESSHKPIPIHSSIANKLGIKA
PPLRIHSQVKYAALARGDAEIYLRFTLKGYREFIWNHAAGAIITTEAGGVVCDADGNPLD
FSRGNHLEHKTGIVVSTKNLMPRLLKAIRESIEEEMLLSETQLKL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgccttacgagaaagagctcgctgctgctaagaaagccgtctctctagctgctcgtctc
agccaggaagtgcagaagtctctgttgcaatcagatgtccggtcaaaatctgataaaagt
ccggttacagctgctgattatggatcccaagctgtgatcagtcatgtactagagagagaa
cttcaccctgaaccactatacttggttgctgaagagaatgcagaagatctgcacaagaat
ggcgccgaggaatttctagaaagcattactaagcttgtgaacaatgctctagcttctgat
gattcctacgccaactcttctctttcaatggatgatgtaaggaaggcgatagaccacggg
aggtcacaaggcggttccagtggccgccattggattcttgatcctgttgatggaaccaga
gggtttgtaaaaggagaggaatacgctgtggcattagctttgcttgtggaaggcaaagta
gtgctcggtgtcatggcttgcccgaaacttgagaatcacaagtcttcttcttcaggatgc
cttttctttgctacagtgggagaaggagcttatgtgcaatcgcttgaaggcgactctcat
cctccacagaaggtgcaagtgagcaacattgagaatcctgaagaagcaacctttgtggaa
tcatcccacaaaccaatccccatccatagctccattgccaataaacttgggatcaaagct
ccacctctaagaatccatagtcaagtgaagtacgcagctctggctcgaggagatgcagag
atatacttgcgtttcactcttaaagggtaccgagagttcatatggaaccatgctgctggt
gcaatcatcacaacagaagctggaggtgtagtttgcgatgctgacgggaatcctctggac
ttctcgagaggaaatcatcttgaacacaaaacagggatcgtggtcagcaccaagaacctt
atgccacggctcttgaaagccattagagaatccatagaagaggagatgcttctctctgag
acacaactgaaactgtaa

DBGET integrated database retrieval system