KEGG   Arabidopsis thaliana (thale cress): AT5G09740Help
Entry
AT5G09740         CDS       T00041                                 

Gene name
HAM2
Definition
(RefSeq) MYST-like histone acetyltransferase 2
  KO
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AT5G09740 (HAM2)
Chromosome [BR:ath03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    AT5G09740 (HAM2)
   HAT complexes
    NSL complex
     AT5G09740 (HAM2)
    MSL complex
     AT5G09740 (HAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 445 aa AA seqDB search
MGSSANTETNGNAPPPSSNQKPPATNGVDGSHPPPPPLTPDQAIIESDPSKKRKMGMLPL
EVGTRVMCRWRDGKHHPVKVIERRRIHNGGQNDYEYYVHYTEFNRRLDEWTQLDQLDLDS
VECAVDEKVEDKVTSLKMTRHQKRKIDETHIEGHEELDAASLREHEEFTKVKNISTIELG
KYEIETWYFSPFPPEYNDCVKLFFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRSGT
LSMFEVDGKKNKVYAQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKE
KHSEEAYNLACILTLPSYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYW
TRVLLEILKKHKGNISIKELSDVTAIKAEDILSTLQSLELIQYRKGQHVICADPKVLDRH
LKAAGRGGLDVDASKLIWTPYKDQS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgggatcgtcagcgaatacagaaaccaacggcaacgcaccgccaccgtcgtcgaatcaa
aagcctccggctacgaacggcgttgatgggtctcatcctcctcctcctcctttaactcct
gatcaagctattatagagtcggatccgtcgaagaagaggaaaatggggatgcttcctcta
gaagtgggtactcgtgtgatgtgtcggtggagagacgggaaacaccatccggtgaaagta
attgagcgccggcggatacataacggcggtcaaaatgattacgagtattacgttcattac
actgagtttaataggaggctggatgaatggactcagctggaccaactggaccttgattca
gtagagtgcgctgtagatgaaaaagtggaagacaaggtaacaagcttgaagatgacacgt
caccagaagaggaagatcgatgagacacatatagagggtcatgaagagctggatgcagca
agtttgcgtgaacatgaagagttcacgaaagtgaagaacatatcaacaattgagcttgga
aaatatgagattgagacttggtacttctccccttttccgccagaatacaatgactgtgtg
aagctctttttttgtgagttttgcctgaacttcatgaaacgcaaagagcagcttcaaagg
catatgaggaagtgtgacctgaagcacccacctggtgatgaaatttaccgaagtggtacc
ttgtcaatgtttgaggtagatggcaaaaagaacaaggtttatgcacagaatctctgctac
ctggcaaagttatttcttgaccacaaaactctttactacgatgttgatttgtttctattc
tacgttctttgcgaatgtgatgaccgaggatgccacatggttgggtacttttcaaaggag
aagcattcggaagaagcatacaacttagcttgcattctaaccctgccttcatatcaaaga
aaaggctatggaaagttcttaatagccttttcctatgaactgtcaaagaaagagggaaaa
gttgggacaccggaaagacccttgtcggatctaggcttactaagctacagaggttattgg
actcgtgttctattagaaatcttgaaaaaacataagggaaacatttctatcaaggagctg
agcgacgtgacagcaatcaaagcggaagatatattaagcacacttcagagcctagaactg
atacagtacaggaaaggacagcatgtgatctgtgcggatccaaaggttctggaccgacat
ctgaaagctgcaggccgaggtggtcttgatgtagatgctagcaaactgatttggacacct
tacaaggaccagagttaa

DBGET integrated database retrieval system