KEGG   Arabidopsis thaliana (thale cress): AT5G09740Help
Entry
AT5G09740         CDS       T00041                                 

Gene name
HAM2
Definition
MYST-like histone acetyltransferase 2
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AT5G09740 (HAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 367 aa AA seqDB search
MGSSANTETNGNAPPPSSNQKPPATNGVDGSHPPPPPLTPDQAIIESDPSKKRKMGMLPL
EVGTRVMCRWRDGKHHPVKVIERRRIHNGGQNDYEYYVHYTEFNRRLDEWTQLDQLDLDS
VECAVDEKVEDKVTSLKMTRHQKRKIDETHIEGHEELDAASLREHEEFTKVKNKVYAQNL
CYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEEAYNLACILTLPSY
QRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWTRVLLEILKKHKGNISIK
ELSDVTAIKAEDILSTLQSLELIQYRKGQHVICADPKVLDRHLKAAGRGGLDVDASKLIW
TPYKDQS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgggatcgtcagcgaatacagaaaccaacggcaacgcaccgccaccgtcgtcgaatcaa
aagcctccggctacgaacggcgttgatgggtctcatcctcctcctcctcctttaactcct
gatcaagctattatagagtcggatccgtcgaagaagaggaaaatggggatgcttcctcta
gaagtgggtactcgtgtgatgtgtcggtggagagacgggaaacaccatccggtgaaagta
attgagcgccggcggatacataacggcggtcaaaatgattacgagtattacgttcattac
actgagtttaataggaggctggatgaatggactcagctggaccaactggaccttgattca
gtagagtgcgctgtagatgaaaaagtggaagacaaggtaacaagcttgaagatgacacgt
caccagaagaggaagatcgatgagacacatatagagggtcatgaagagctggatgcagca
agtttgcgtgaacatgaagagttcacgaaagtgaagaacaaggtttatgcacagaatctc
tgctacctggcaaagttatttcttgaccacaaaactctttactacgatgttgatttgttt
ctattctacgttctttgcgaatgtgatgaccgaggatgccacatggttgggtacttttca
aaggagaagcattcggaagaagcatacaacttagcttgcattctaaccctgccttcatat
caaagaaaaggctatggaaagttcttaatagccttttcctatgaactgtcaaagaaagag
ggaaaagttgggacaccggaaagacccttgtcggatctaggcttactaagctacagaggt
tattggactcgtgttctattagaaatcttgaaaaaacataagggaaacatttctatcaag
gagctgagcgacgtgacagcaatcaaagcggaagatatattaagcacacttcagagccta
gaactgatacagtacaggaaaggacagcatgtgatctgtgcggatccaaaggttctggac
cgacatctgaaagctgcaggccgaggtggtcttgatgtagatgctagcaaactgatttgg
acaccttacaaggaccagagttaa

DBGET integrated database retrieval system