KEGG   Arabidopsis thaliana (thale cress): AT5G10240Help
Entry
AT5G10240         CDS       T00041                                 

Gene name
ASN3
Definition
asparagine synthetase 3
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ath00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 577 aa AA seqDB search
MCGILAVLGCVDNSQAKRSRIIELSRRLRHRGPDWSGLHCYEDCYLAHERLAIVDPTSGD
QPLYNEDKTIAVTVNGEIYNHKALRENLKSHQFRTGSDCEVIAHLVKHGEEFVDMLDGMF
AFVLLDTRDKSFIAARDAIGITPLYIGWGLDGSVWFASEMKALSDDCEQFMCFPPGHIYS
SKQGGLRRWYNPPWFSEVVPSTPYDPLVVRNTFEKAVIKRLMTDVPFGVLLSGGLDSSLV
ASVALRHLEKSEAACQWGSKLHTFCIGLKGSPDLKAGREVADYLGTRHHELHFTVQDGID
AIEEVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKMVLSGEGSDEIFGGYLYFHKAPNK
KEFHEETCRKIKALHQYDCLRANKSTSAWGVEARVPFLDKEFINVAMSIDPEWKMIRPDL
GRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVGYSWIDGLKDHANKHVSETMLMNA
SFVFPDNTPLTKEAYYYRTIFEKFFPKSAARATVPGGPSVACSTAKAVEWDAAWSQNLDP
SGRAALGVHVSAYGEDKTEDSRPEKLQKLAEKTPAIV
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggattctcgctgtgttaggctgcgtcgataactctcaagctaaacgttcccgt
atcatcgaactctctcgcagattgaggcatagaggtcctgactggagtggtctacattgt
tatgaggattgttatttggctcatgagcgtttggctatcgttgaccccacttctggagat
caaccactctataacgaagataagaccattgctgtcacggtcaatggagagatttacaac
cacaaggctttgcgtgaaaatttgaagtctcaccaattccgtactgggagtgattgtgaa
gtgattgcccatcttgtaaaacatggagaggaatttgtcgacatgttggatggcatgttt
gcatttgtgcttcttgatacccgagacaaaagctttattgctgcaagggatgccattggt
atcactccactctacatcgggtggggtctcgatggttctgtttggtttgcttccgagatg
aaagcacttagtgatgattgtgagcagtttatgtgcttccccccaggccacatctattca
agtaaacaaggtgggcttaggaggtggtacaaccccccgtggttctctgaggttgttcct
tcaaccccatatgatcccctagtggtgcgcaatacttttgagaaggctgttataaaacga
ctaatgactgatgtgccttttggtgtcctcctatctggtggattagattcatcccttgtt
gcttcagtagcattacgccatctggaaaaatcagaagctgcttgtcagtggggttcaaag
ttgcacacattttgtatcggtttgaagggatccccggatcttaaagctggcagagaagtc
gctgactatttaggaactcgccaccacgagttacactttacagttcaggacggaatagat
gccatagaagaagtcatctaccatgttgagacctatgatgtgactactattagagccagc
actccaatgtttcttatgtcgcgaaaaatcaaatcgcttggtgtaaagatggttctttct
ggggaaggctctgatgaaatttttggaggatatttgtacttccataaagctcccaacaag
aaggaatttcatgaggaaacatgtcgaaagatcaaagctcttcatcaatatgactgcttg
agggctaacaaatcaacttctgcatggggtgttgaggctcgtgtacctttcctcgataaa
gaatttataaatgtcgcaatgagcatcgatccagagtggaagatgattaggcctgatttg
ggaaggatcgagaaatgggtgttacgcaatgcctttgatgatgagaaaaatccttaccta
ccaaagcacattctatataggcagaaagaacagttcagtgatggagttggatacagctgg
attgatggtctaaaagatcatgcaaacaaacatgtctctgagacaatgctgatgaacgca
agctttgtcttccctgataacacacctttgacaaaagaagcttactactacagaaccatc
tttgaaaagttcttccctaagagtgctgctagagcaactgtaccaggaggtccaagtgtg
gcatgtagcacagcaaaagctgtggaatgggacgcagcttggtcacagaatcttgaccca
tcaggtcgtgcggctcttggagttcatgtttcagcttatggggaagataaaaccgaagat
tctcgtcccgagaagctacagaaactagcagagaagactccagccattgtttga

DBGET integrated database retrieval system