KEGG   Arabidopsis thaliana (thale cress): AT5G10240Help
Entry
AT5G10240         CDS       T00041                                 

Gene name
ASN3
Definition
(RefSeq) asparagine synthetase 3
  KO
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT5G10240 (ASN3)
Enzymes [BR:ath01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     AT5G10240 (ASN3)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C44
   AT5G10240 (ASN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 578 aa AA seqDB search
MCGILAVLGCVDNSQAKRSRIIELSRRLRHRGPDWSGLHCYEDCYLAHERLAIVDPTSGD
QPLYNEDKTIAVTVNGEIYNHKALRENLKSHQFRTGSDCEVIAHLYEEHGEEFVDMLDGM
FAFVLLDTRDKSFIAARDAIGITPLYIGWGLDGSVWFASEMKALSDDCEQFMCFPPGHIY
SSKQGGLRRWYNPPWFSEVVPSTPYDPLVVRNTFEKAVIKRLMTDVPFGVLLSGGLDSSL
VASVALRHLEKSEAACQWGSKLHTFCIGLKGSPDLKAGREVADYLGTRHHELHFTVQDGI
DAIEEVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKMVLSGEGSDEIFGGYLYFHKAPN
KKEFHEETCRKIKALHQYDCLRANKSTSAWGVEARVPFLDKEFINVAMSIDPEWKMIRPD
LGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVGYSWIDGLKDHANKHVSETMLMN
ASFVFPDNTPLTKEAYYYRTIFEKFFPKSAARATVPGGPSVACSTAKAVEWDAAWSQNLD
PSGRAALGVHVSAYGEDKTEDSRPEKLQKLAEKTPAIV
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggattctcgctgtgttaggctgcgtcgataactctcaagctaaacgttcccgt
atcatcgaactctctcgcagattgaggcatagaggtcctgactggagtggtctacattgt
tatgaggattgttatttggctcatgagcgtttggctatcgttgaccccacttctggagat
caaccactctataacgaagataagaccattgctgtcacggtcaatggagagatttacaac
cacaaggctttgcgtgaaaatttgaagtctcaccaattccgtactgggagtgattgtgaa
gtgattgcccatctttacgaagaacatggagaggaatttgtcgacatgttggatggcatg
tttgcatttgtgcttcttgatacccgagacaaaagctttattgctgcaagggatgccatt
ggtatcactccactctacatcgggtggggtctcgatggttctgtttggtttgcttccgag
atgaaagcacttagtgatgattgtgagcagtttatgtgcttccccccaggccacatctat
tcaagtaaacaaggtgggcttaggaggtggtacaaccccccgtggttctctgaggttgtt
ccttcaaccccatatgatcccctagtggtgcgcaatacttttgagaaggctgttataaaa
cgactaatgactgatgtgccttttggtgtcctcctatctggtggattagattcatccctt
gttgcttcagtagcattacgccatctggaaaaatcagaagctgcttgtcagtggggttca
aagttgcacacattttgtatcggtttgaagggatccccggatcttaaagctggcagagaa
gtcgctgactatttaggaactcgccaccacgagttacactttacagttcaggacggaata
gatgccatagaagaagtcatctaccatgttgagacctatgatgtgactactattagagcc
agcactccaatgtttcttatgtcgcgaaaaatcaaatcgcttggtgtaaagatggttctt
tctggggaaggctctgatgaaatttttggaggatatttgtacttccataaagctcccaac
aagaaggaatttcatgaggaaacatgtcgaaagatcaaagctcttcatcaatatgactgc
ttgagggctaacaaatcaacttctgcatggggtgttgaggctcgtgtacctttcctcgat
aaagaatttataaatgtcgcaatgagcatcgatccagagtggaagatgattaggcctgat
ttgggaaggatcgagaaatgggtgttacgcaatgcctttgatgatgagaaaaatccttac
ctaccaaagcacattctatataggcagaaagaacagttcagtgatggagttggatacagc
tggattgatggtctaaaagatcatgcaaacaaacatgtctctgagacaatgctgatgaac
gcaagctttgtcttccctgataacacacctttgacaaaagaagcttactactacagaacc
atctttgaaaagttcttccctaagagtgctgctagagcaactgtaccaggaggtccaagt
gtggcatgtagcacagcaaaagctgtggaatgggacgcagcttggtcacagaatcttgac
ccatcaggtcgtgcggctcttggagttcatgtttcagcttatggggaagataaaaccgaa
gattctcgtcccgagaagctacagaaactagcagagaagactccagccattgtttga

DBGET integrated database retrieval system