KEGG   Arabidopsis thaliana (thale cress): AT5G11260Help
Entry
AT5G11260         CDS       T00041                                 

Gene name
HY5
Definition
(RefSeq) transcription factor HY5
  KO
K16241  
transcription factor HY5
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G11260 (HY5)
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   Plant G-box-binding factors
    AT5G11260 (HY5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
5
AA seq 168 aa AA seqDB search
MQEQATSSLAASSLPSSSERSSSSAPHLEIKEGIESDEEIRRVPEFGGEAVGKETSGRES
GSATGQERTQATVGESQRKRGRTPAEKENKRLKRLLRNRVSAQQARERKKAYLSELENRV
KDLENKNSELEERLSTLQNENQMLRHILKNTTGNKRGGGGGSNADASL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaacaagcgactagctctttagctgcaagctctttaccatcaagcagcgagagg
tcatcaagctctgctccacatttggagatcaaagaaggaattgaaagcgatgaggagata
cggcgagtgccggagtttggaggagaagctgtcggaaaagaaacttccggtagagaatct
ggatcggcgaccggtcaggagcggacacaggcgactgtcggagaaagtcaaaggaagcga
gggaggacaccggcggagaaagagaacaagcggctgaagaggttgttgaggaacagagtt
tcagctcagcaagcaagagagaggaaaaaggcttacttgagcgagttggaaaacagagtg
aaagacttggagaacaaaaactctgaacttgaagagcgactctctactcttcagaacgag
aaccagatgcttagacatattctgaagaacacaacaggaaacaagagaggaggtggtggt
ggttctaatgctgatgcaagcctttga

DBGET integrated database retrieval system