KEGG   Arabidopsis thaliana (thale cress): AT5G11260Help
Entry
AT5G11260         CDS       T00041                                 

Gene name
HY5
Definition
(RefSeq) Basic-leucine zipper (bZIP) transcription factor family protein
  KO
K16241  transcription factor HY5
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G11260 (HY5)
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   Plant G-box-binding factors
    AT5G11260 (HY5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 GAS Phlebovirus_NSM Lebercilin bZIP_Maf FlaC_arch Gal4_dimer Nnf1 NBP1 DUF3563 HAUS2 GIT_CC Fmp27_WPPW TSC22 Aminopep SHE3 DUF5320 Herpes_BLRF2 DUF737 V_ATPase_I HAUS6_N Jnk-SapK_ap_N Spc7 DMPK_coil APG6 Pneumo_att_G EMP24_GP25L IncA
Motif
Other DBs
NCBI-GeneID: 830996
NCBI-ProteinID: NP_568246
MIPS: AT5G11260.1
TAIR: AT5G11260
Araport: AT5G11260
UniProt: O24646 Q1H5E5 A0A178URW8
Structure
PDB: 

Jmol
Position
5
AA seq 168 aa AA seqDB search
MQEQATSSLAASSLPSSSERSSSSAPHLEIKEGIESDEEIRRVPEFGGEAVGKETSGRES
GSATGQERTQATVGESQRKRGRTPAEKENKRLKRLLRNRVSAQQARERKKAYLSELENRV
KDLENKNSELEERLSTLQNENQMLRHILKNTTGNKRGGGGGSNADASL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaacaagcgactagctctttagctgcaagctctttaccatcaagcagcgagagg
tcatcaagctctgctccacatttggagatcaaagaaggaattgaaagcgatgaggagata
cggcgagtgccggagtttggaggagaagctgtcggaaaagaaacttccggtagagaatct
ggatcggcgaccggtcaggagcggacacaggcgactgtcggagaaagtcaaaggaagcga
gggaggacaccggcggagaaagagaacaagcggctgaagaggttgttgaggaacagagtt
tcagctcagcaagcaagagagaggaaaaaggcttacttgagcgagttggaaaacagagtg
aaagacttggagaacaaaaactctgaacttgaagagcgactctctactcttcagaacgag
aaccagatgcttagacatattctgaagaacacaacaggaaacaagagaggaggtggtggt
ggttctaatgctgatgcaagcctttga

DBGET integrated database retrieval system