KEGG   Arabidopsis thaliana (thale cress): AT5G13930Help
Entry
AT5G13930         CDS       T00041                                 

Gene name
TT4
Definition
chalcone synthase
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Module
Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    AT5G13930 (TT4)
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G13930 (TT4)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     AT5G13930 (TT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 395 aa AA seqDB search
MVMAGASSLDEIRQAQRADGPAGILAIGTANPENHVLQAEYPDYYFRITNSEHMTDLKEK
FKRMCDKSTIRKRHMHLTEEFLKENPHMCAYMAPSLDTRQDIVVVEVPKLGKEAAVKAIK
EWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRIAK
DLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEK
PIFEMVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIVKSLDEAFKPLGISD
WNSLFWIAHPGGPAILDQVEIKLGLKEEKMRATRHVLSEYGNMSSACVLFILDEMRRKSA
KDGVATTGEGLEWGVLFGFGPGLTVETVVLHSVPL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtgatggctggtgcttcttctttggatgagatcagacaggctcagagagctgatgga
cctgcaggcatcttggctattggcactgctaaccctgagaaccatgtgcttcaggcggag
tatcctgactactacttccgcatcaccaacagtgaacacatgaccgacctcaaggagaag
ttcaagcgcatgtgcgacaagtcgacaattcggaaacgtcacatgcatctgacggaggaa
ttcctcaaggaaaacccacacatgtgtgcttacatggctccttctctggacaccagacag
gacatcgtggtggtcgaagtccctaagctaggcaaagaagcggcagtgaaggccatcaag
gagtggggccagcccaagtcaaagatcactcatgtcgtcttctgcactacctccggcgtc
gacatgcctggtgctgactaccagctcaccaagcttcttggtctccgtccttccgtcaag
cgtctcatgatgtaccagcaaggttgcttcgccggcggtactgtcctccgtatcgctaag
gatctcgccgagaacaatcgtggagcacgtgtcctcgttgtctgctctgagatcacagcc
gttaccttccgtggtccctctgacacccaccttgactccctcgtcggtcaggctcttttc
agtgatggcgccgccgcactcattgtggggtcggaccctgacacatctgtcggagagaaa
cccatctttgagatggtgtctgccgctcagaccatccttccagactctgatggtgccata
gacggacatttgagggaagttggtctcaccttccatctcctcaaggatgttcccggcctc
atctccaagaacattgtgaagagtctagacgaagcgtttaaacctttggggataagtgac
tggaactccctcttctggatagcccaccctggaggtccagcgatcctagaccaggtggag
ataaagctaggactaaaggaagagaagatgagggcgacacgtcacgtgttgagcgagtat
ggaaacatgtcgagcgcgtgcgttctcttcatactagacgagatgaggaggaagtcagct
aaggatggtgtggccacgacaggagaagggttggagtggggtgtcttgtttggtttcgga
ccaggtctcactgttgagacagtcgtcttgcacagcgttcctctctaa

DBGET integrated database retrieval system