KEGG   Arabidopsis thaliana (thale cress): AT5G13960Help
Entry
AT5G13960         CDS       T00041                                 

Gene name
SUVH4
Definition
histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AT5G13960 (SUVH4)
Enzymes [BR:ath01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AT5G13960 (SUVH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 624 aa AA seqDB search
MAGKRKRANAPDQTERRSSVRVQKVRQKALDEKARLVQERVKLLSDRKSEICVDDTELHE
KEEENVDGSPKRRSPPKLTAMQKGKQKLSVSLNGKDVNLEPHLKVTKCLRLFNKQYLLCV
QAKLSRPDLKGVTEMIKAKAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNGID
YMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVTYTGQGGHNLTGNKRQIKDQLLE
RGNLALKHCCEYNVPVRVTRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKYRL
KRLEGQPELTTDQVNFVAGRIPTSTSEIEGLVCEDISGGLEFKGIPATNRVDDSPVSPTS
GFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSKKCACAKLNGGNFPYVDLNDGRLIESRD
VVFECGPHCGCGPKCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVCEYIGVVR
RTADVDTISDNEYIFEIDCQQTMQGLGGRQRRLRDVAVPMNNGVSQSSEDENAPEFCIDA
GSTGNFARFINHSCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYDYGYALDSV
HGPDGKVKQLACYCGALNCRKRLY
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggctggaaaaaggaaacgagctaatgctcctgaccaaacagagcgaagatcgagtgtt
cgggttcagaaagtgagacagaaagcgttagatgagaaggcgcgtttagtacaggagagg
gttaagctcctcagtgacagaaagagtgaaatttgtgtcgatgacactgagttacatgag
aaagaagaggaaaatgtcgatgggagccctaaacgaagaagccctccaaagctaaccgca
atgcagaaaggaaagcagaaattgagtgtttctctgaatggtaaggacgtgaacttggaa
cctcatctcaaagtgacaaagtgtctgaggttatttaacaagcaatatctcctctgtgtc
caggctaagttgagcaggcctgatttgaagggtgtaactgagatgataaaagctaaggcg
atattgtacccaagaaaaataatcggtgaccttccaggtatagacgttggacaccgtttt
ttttcaagagctgaaatgtgtgctgtaggattccataaccattggctaaatggcattgat
tatatgtcaatggaatacgaaaaagagtatagtaactacaaattaccgcttgctgtttct
attgttatgtcgggccagtacgaggatgatctagacaatgcagatacagtgacttacact
ggacagggagggcataacttaactggtaataaacgtcagataaaggatcaacttttagaa
cgagggaatttggcgctaaagcactgctgcgaatataatgtgcctgtcagagtaactcgt
ggtcacaattgcaaaagtagctataccaaacgagtatacacttatgatggactgtacaag
gttgaaaagttctgggcacaaaagggcgtttcaggatttacagtgtataagtaccgactg
aaacgattggaggggcaaccagaactaactactgatcaggtcaactttgttgctggacgc
ataccaacgagtacttcagaaattgagggtttggtatgtgaggacatctccggagggcta
gaatttaagggtatccccgccactaatcgtgttgatgattcaccagtttcaccaacatct
ggtttcacatacatcaaatctttgattattgagcctaatgtcataattccaaagagttca
actgggtgtaactgccgaggcagctgcactgactcaaagaaatgtgcatgtgctaagctt
aatgggggtaactttccatatgttgaccttaatgatggcagattaattgagtctcgagat
gttgtatttgaatgtggtcctcactgtgggtgtgggccaaaatgtgtcaaccgaacttct
cagaagcgtctaagattcaatcttgaggttttccgctctgcaaagaagggttgggcagtt
agatcatgggagtacataccagctggttcaccagtatgtgagtacataggagttgtcagg
agaactgctgatgtggatactatctctgacaatgaatacatatttgagattgactgccaa
cagacaatgcaaggtcttggtggaagacagagaagactaagagatgttgctgtaccaatg
aataatggagtcagtcagagcagtgaagatgagaatgcgccagagttctgcattgatgct
ggttcaacaggaaactttgctaggtttataaatcacagttgtgaaccaaacctatttgtt
cagtgcgtcctgagttctcaccaggatataaggcttgcccgtgtggttcttttcgcagct
gacaacatttccccaatgcaggagctcacttacgactatggatatgcgcttgatagcgtt
catggaccggatgggaaggtgaagcagctcgcttgctactgtggagcgctaaattgtagg
aaacgcctttactaa

DBGET integrated database retrieval system