KEGG   Arabidopsis thaliana (thale cress): AT5G14220Help
Entry
AT5G14220         CDS       T00041                                 

Gene name
HEMG2
Definition
(RefSeq) protoporphyrinogen oxidase-like protein
  KO
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AT5G14220 (HEMG2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     AT5G14220 (HEMG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 508 aa AA seqDB search
MASGAVADHQIEAVSGKRVAVVGAGVSGLAAAYKLKSRGLNVTVFEADGRVGGKLRSVMQ
NGLIWDEGANTMTEAEPEVGSLLDDLGLREKQQFPISQKKRYIVRNGVPVMLPTNPIELV
TSSVLSTQSKFQILLEPFLWKKKSSKVSDASAEESVSEFFQRHFGQEVVDYLIDPFVGGT
SAADPDSLSMKHSFPDLWNVEKSFGSIIVGAIRTKFAAKGGKSRDTKSSPGTKKGSRGSF
SFKGGMQILPDTLCKSLSHDEINLDSKVLSLSYNSGSRQENWSLSCVSHNETQRQNPHYD
AVIMTAPLCNVKEMKVMKGGQPFQLNFLPEINYMPLSVLITTFTKEKVKRPLEGFGVLIP
SKEQKHGFKTLGTLFSSMMFPDRSPSDVHLYTTFIGGSRNQELAKASTDELKQVVTSDLQ
RLLGVEGEPVSVNHYYWRKAFPLYDSSYDSVMEAIDKMENDLPGFFYAGNHRGGLSVGKS
IASGCKAADLVISYLESCSNDKKPNDSL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctggagcagtagcagatcatcaaattgaagcggtttcaggaaaaagagtcgca
gtcgtaggtgcaggtgtaagtggacttgcggcggcttacaagttgaaatcgaggggtttg
aatgtgactgtgtttgaagctgatggaagagtaggtgggaagttgagaagtgttatgcaa
aatggtttgatttgggatgaaggagcaaacaccatgactgaggctgagccagaagttggg
agtttacttgatgatcttgggcttcgtgagaaacaacaatttccaatttcacagaaaaag
cggtatattgtgcggaatggtgtacctgtgatgctacctaccaatcccatagagctggtc
acaagtagtgtgctctctacccaatctaagtttcaaatcttgttggaaccatttttatgg
aagaaaaagtcctcaaaagtctcagatgcatctgctgaagaaagtgtaagcgagttcttt
caacgccattttggacaagaggttgttgactatctcatcgacccttttgttggtggaaca
agtgctgcggaccctgattccctttcaatgaagcattctttcccagatctctggaatgta
gagaaaagttttggctctattatagtcggtgcaatcagaacaaagtttgctgctaaaggt
ggtaaaagtagagacacaaagagttctcctggcacaaaaaagggttcgcgtgggtcattc
tcttttaaggggggaatgcagattcttcctgatacgttgtgcaaaagtctctcacatgat
gagatcaatttagactccaaggtactctctttgtcttacaattctggatcaagacaggag
aactggtcattatcttgtgtttcgcataatgaaacgcagagacaaaacccccattatgat
gctgtaattatgacggctcctctgtgcaatgtgaaggagatgaaggttatgaaaggagga
caaccctttcagctaaactttctccccgagattaattacatgcccctctcggttttaatc
accacattcacaaaggagaaagtaaagagacctcttgaaggctttggggtactcattcca
tctaaggagcaaaagcatggtttcaaaactctaggtacacttttttcatcaatgatgttt
ccagatcgttcccctagtgacgttcatctatatacaacttttattggtgggagtaggaac
caggaactagccaaagcttccactgacgaattaaaacaagttgtgacttctgaccttcag
cgactgttgggggttgaaggtgaacccgtgtctgtcaaccattactattggaggaaagca
ttcccgttgtatgacagcagctatgactcagtcatggaagcaattgacaagatggagaat
gatctacctgggttcttctatgcaggtaatcatcgaggggggctctctgttgggaaatca
atagcatcaggttgcaaagcagctgaccttgtgatctcatacctggagtcttgctcaaat
gacaagaaaccaaatgacagcttataa

DBGET integrated database retrieval system