KEGG   Arabidopsis thaliana (thale cress): AT5G14740Help
Entry
AT5G14740         CDS       T00041                                 

Gene name
CA2
Definition
(RefSeq) carbonic anhydrase 2
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    AT5G14740 (CA2)
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     AT5G14740 (CA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_CA
Motif
Other DBs
NCBI-GeneID: 831326
NCBI-ProteinID: NP_568303
MIPS: AT5G14740.1
TAIR: AT5G14740
Araport: AT5G14740
UniProt: P42737
Position
5
AA seq 331 aa AA seqDB search
MVPFWTTVSRNGSSDSETTLQSASKATKQYKYPSLRPSHRLSLLFLFPFHLSANGACFRC
TCFSHFKLELRRMGNESYEDAIEALKKLLIEKDDLKDVAAAKVKKITAELQAASSSDSKS
FDPVERIKEGFVTFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFHPGDA
FVVRNIANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNN
STDFIEDWVKICLPAKSKVLAESESSAFEDQCGRCEREAVNVSLANLLTYPFVREGVVKG
TLALKGGYYDFVNGSFELWELQFGISPVHSI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggtccccttttggactacagtttctcgaaatggctcatcagactcagagacgactctc
caatctgcttcaaaagccacaaaacagtataaatatccttctcttcgtccctctcatcgc
ctgtctctcctcttcctcttcccgttccatttatccgcaaacggagcttgttttcggtgc
acctgcttcagccacttcaaacttgaactgagaaggatgggaaacgaatcatatgaagac
gccatcgaagctctcaagaagcttctcattgagaaggatgatctgaaggatgtagctgcg
gccaaggtgaagaagatcacggcggagcttcaggcagcctcgtcatcggacagcaaatct
tttgatcccgtcgaacgaattaaggaaggcttcgtcaccttcaagaaggagaaatacgag
accaatcctgctttgtatggtgagctcgccaaaggtcaaagcccaaagtacatggtgttt
gcttgttcggactcacgagtgtgcccatcacacgtactagacttccatcctggagatgcc
ttcgtggttcgtaatatcgccaatatggttcctccttttgacaaggtcaaatatgcagga
gttggagccgccattgaatacgctgtcttgcaccttaaggtggaaaacattgtggtgata
gggcacagtgcatgtggtggcatcaaggggcttatgtcatttcctcttgacggaaacaac
tctactgacttcatagaggattgggtcaaaatctgtttaccagcaaagtcaaaagttttg
gcagaaagtgaaagttcagcatttgaagaccaatgtggccgatgcgaaagggaggcagtg
aatgtgtcactagcaaacctattgacatatccatttgtgagagaaggagttgtgaaagga
acacttgctttgaagggaggctactatgactttgttaatggctcctttgagctttgggag
ctccagtttggaatttcccccgttcattctatatga

DBGET integrated database retrieval system