KEGG   Arabidopsis thaliana (thale cress): AT5G14740Help
Entry
AT5G14740         CDS       T00041                                 

Gene name
CA2
Definition
(RefSeq) carbonic anhydrase 2
  KO
K01673  
carbonic anhydrase [EC:4.2.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    AT5G14740 (CA2)
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonate dehydratase
     AT5G14740 (CA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 331 aa AA seqDB search
MVPFWTTVSRNGSSDSETTLQSASKATKQYKYPSLRPSHRLSLLFLFPFHLSANGACFRC
TCFSHFKLELRRMGNESYEDAIEALKKLLIEKDDLKDVAAAKVKKITAELQAASSSDSKS
FDPVERIKEGFVTFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFHPGDA
FVVRNIANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNN
STDFIEDWVKICLPAKSKVLAESESSAFEDQCGRCEREAVNVSLANLLTYPFVREGVVKG
TLALKGGYYDFVNGSFELWELQFGISPVHSI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggtccccttttggactacagtttctcgaaatggctcatcagactcagagacgactctc
caatctgcttcaaaagccacaaaacagtataaatatccttctcttcgtccctctcatcgc
ctgtctctcctcttcctcttcccgttccatttatccgcaaacggagcttgttttcggtgc
acctgcttcagccacttcaaacttgaactgagaaggatgggaaacgaatcatatgaagac
gccatcgaagctctcaagaagcttctcattgagaaggatgatctgaaggatgtagctgcg
gccaaggtgaagaagatcacggcggagcttcaggcagcctcgtcatcggacagcaaatct
tttgatcccgtcgaacgaattaaggaaggcttcgtcaccttcaagaaggagaaatacgag
accaatcctgctttgtatggtgagctcgccaaaggtcaaagcccaaagtacatggtgttt
gcttgttcggactcacgagtgtgcccatcacacgtactagacttccatcctggagatgcc
ttcgtggttcgtaatatcgccaatatggttcctccttttgacaaggtcaaatatgcagga
gttggagccgccattgaatacgctgtcttgcaccttaaggtggaaaacattgtggtgata
gggcacagtgcatgtggtggcatcaaggggcttatgtcatttcctcttgacggaaacaac
tctactgacttcatagaggattgggtcaaaatctgtttaccagcaaagtcaaaagttttg
gcagaaagtgaaagttcagcatttgaagaccaatgtggccgatgcgaaagggaggcagtg
aatgtgtcactagcaaacctattgacatatccatttgtgagagaaggagttgtgaaagga
acacttgctttgaagggaggctactatgactttgttaatggctcctttgagctttgggag
ctccagtttggaatttcccccgttcattctatatga

DBGET integrated database retrieval system