KEGG   Arabidopsis thaliana (thale cress): AT5G14760Help
Entry
AT5G14760         CDS       T00041                                 

Gene name
AO
Definition
(RefSeq) L-aspartate oxidase
  KO
K00278  
L-aspartate oxidase [EC:1.4.3.16]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Alanine, aspartate and glutamate metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT5G14760 (AO)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AT5G14760 (AO)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.16  L-aspartate oxidase
     AT5G14760 (AO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 651 aa AA seqDB search
MAAHVSTGNIHNFYLAGQVYRGQAFSWSSASTFMANPFKEPSWSSGVFKALKAERCGCYS
RGISPISETSKPIRAVSVSSSTKYYDFTVIGSGVAGLRYALEVAKQGTVAVITKDEPHES
NTNYAQGGVSAVLCPLDSVESHMRDTMVAGAHLCDEETVRVVCTEGPERIRELIAMGASF
DHGEDGNLHLAREGGHSHCRIVHAADMTGREIERALLEAVLNDPNISVFKHHFAIDLLTS
QDGLNTVCHGVDTLNIKTNEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAHRA
QAVISNMEFVQFHPTALADEGLPIKLQTARENAFLITEAVRGDGGILYNLGMERFMPVYD
ERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPREKILAHFPNIASECLKHGLDITRQ
PIPVVPAAHYMCGGVRAGLQGETNVLGLFVAGEVACTGLHGANRLASNSLLEALVFARRA
VQPSTELMKRTRLDVCASEKWTRPVVATARLLGDEVIAKIIALTKEVRRELQEVMWKYVG
IVRSTIRLTTAERKIAELEAKWETFLFEHGWEQTVVALEACEMRNLFCCAKLVVSSALAR
HESRGLHYMTDFPFVEESKRIPTIILPSSPTTASWSSRRLQNISSSSLIDC
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcatgtttctactggaaacattcataatttctatcttgcggggcaggtttac
aggggacaagctttttcatggagttctgcttctactttcatggcaaatccattcaaagag
ccctcttggtcaagtggggtatttaaggctctaaaagctgagagatgtggttgttactct
cgtggtatttcccccatcagtgagacctcaaaacctatcagggctgtttcggtatcttct
tcaacaaagtattatgatttcactgtgattggtagtggagtagcgggtctgcgttatgct
ttagaagttgcaaagcaaggaacagtcgcagtgattaccaaagatgagcctcatgagagt
aacacaaactatgctcaaggtggtgttagtgctgtgttatgccctttggattctgttgaa
agtcatatgcgggacactatggtcgctggtgctcatctttgtgatgaagaaaccgtaaga
gttgtgtgtactgaagggcctgaaaggattcgtgaactgattgcaatgggagcatcattt
gatcacggcgaggatggaaatttgcatttggccagagagggtggtcactcgcattgtagg
atcgttcacgctgctgatatgacaggaagagagattgagagagctttacttgaagctgta
cttaatgatcccaacatatctgtcttcaaacaccattttgcaatcgatctgctcacttct
caggatggcttgaacacagtttgtcatggtgtggacactttgaatatcaaaactaatgag
gtagtacgctttatatcgaaggtgacattgcttgcttcaggtggagctgggcatatctat
ccatcaaccacaaatcctctggtggctactggagatgggatggcgatggctcatcgagct
caagctgtgatctcaaatatggaatttgtgcagtttcatcctactgccctagccgacgaa
ggtcttcccatcaaactacaaactgctagggaaaacgcgttcctcatcaccgaggcggtg
agaggtgatggtggcatcctctataatctaggaatggagcgattcatgcctgtttacgat
gaacgagctgagcttgctccaagagacgtggttgcaagaagtattgatgaccagcttaag
aaacgaaacgaaaagtatgtgttacttgacataagccataagccaagagaaaagattctt
gcccatttcccgaacatagcttctgaatgtcttaaacacggtctggatatcacccgtcag
cctattccggttgtccctgcagcccattacatgtgtggaggagttcgtgctggtttacaa
ggcgaaaccaatgtccttggattgtttgtagcaggtgaagtagcatgtacaggcctccac
ggggcaaatcgtcttgctagtaactcgcttttagaagctctggttttcgcgagacgggct
gttcagccttcgactgagctcatgaaacgcacaagacttgatgtatgcgcatcagagaaa
tggacaaggcctgttgttgcgacagctagattgctaggagatgaagtaatagcaaagatt
atagctttgactaaagaagtgagaagagagcttcaggaggtaatgtggaagtatgttggt
attgtcagatcgacaattcggctcaccactgctgagaggaaaatcgcagagctagaagca
aaatgggaaacatttttgtttgaacatggatgggaacaaacagtggtagctcttgaagct
tgtgagatgagaaacttgttctgttgcgctaagcttgtggtgagcagcgcgttagctaga
catgaaagcagaggtcttcattacatgacagactttccttttgtggaagaaagcaagcgg
attccgacgattattctaccgtcttctcctacaacagctagttggagctcaaggcggtta
cagaatataagtagcagctcacttattgattgctaa

DBGET integrated database retrieval system