KEGG   Arabidopsis thaliana (thale cress): AT5G15140Help
Entry
AT5G15140         CDS       T00041                                 

Definition
aldose 1-epimerase-like protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT5G15140
   00052 Galactose metabolism
    AT5G15140
Enzymes [BR:ath01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AT5G15140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 490 aa AA seqDB search
MARSSVLLCLILLVTLGVVISVTFADNVELKSKDLESSKKDKKVDHDSTHKEKGGEKVDG
AGSDDEDNDKKEKKKEHDVQKKDKQHENKDKDDEKKHVDKKKSGGHDKDDDDEKKHKDKK
KDGHNDDDDSDDDTDDDDDDDDDDDDDDEVDGDDNEKEKIGLYELKKGNLTVKFTNWGAS
IISLHFPDKNGKMDDIVLGYDSVKTYKTDKVYFGATVGRVANRIGKGKFKLNGKEYKTSV
NDGKNTLHGGKKGFGDVVWAVAKHQYDGKKPHIVFTHTSPDGDQGFPGELSVTVTYKLVK
DNELSVVMEAKPKDKATPVNLAHHSYWNLGGHNSGDILSEEIQILGSGYTPVDGELIPTG
KINPVKGTAYDFLQLRPIKDNMKDLKTGYDINYCLDGKAKKMRKIVELVDKKSGRKMELS
GNQAGLQFYTGGMLKDVKGKNGAVYQAFGGLCLETQSYPDALNHPKFPSQIVEPGKKYKH
TMLFKFSIVS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcgagaagttctgttttgctatgtttaattctattggttacgttaggagttgtgata
agtgtcacatttgccgacaacgttgaattgaaatcaaaagatctagagagcagtaagaaa
gataagaaggttgatcatgatagtacacacaaagagaagggaggtgaaaaggtagatggt
gccggttctgatgatgaagacaacgataaaaaagaaaaaaagaaagagcatgatgtgcaa
aaaaaggataaacaacatgaaaacaaagacaaggatgacgagaagaagcatgttgataag
aagaagagcggtggtcatgataaagatgatgatgatgaaaagaagcacaaggataaaaag
aaggatggacacaatgatgatgatgatagtgatgatgatacggatgatgacgatgacgat
gatgatgatgatgatgatgatgatgaagttgatggagatgataatgagaaggagaaaatt
gggttatacgagctcaagaagggaaatctaactgtcaaattcacaaattggggtgcttca
atcatatctctccatttcccagacaaaaatggtaaaatggacgatattgttcttggctat
gatagcgtcaaaacctacaagaccgacaaggtttatttcggagcaaccgttggccgagta
gcaaatagaataggaaagggcaaattcaagttgaatggtaaagagtacaagacaagtgtc
aacgatggaaaaaacacactccatggtggcaagaaagggtttggggatgttgtgtgggca
gttgcaaaacaccagtacgatggcaagaaaccacacattgtcttcactcacacaagtcct
gacggcgatcaagggtttccgggagaactcagtgtcacggtgacatataaacttgtcaaa
gacaatgaattgagtgtggtgatggaggcaaagcctaaggataaagcaactccggtgaac
ttagctcatcatagttattggaatcttggtggtcataattccggagatattttgtctgaa
gaaattcaaatcctcggctcgggttatacccccgtcgacggtgagctcattcccaccggg
aaaatcaatccggtgaaaggaacagcatacgattttctccaactccgtcctattaaagat
aatatgaaggatcttaaaacaggatatgatataaattattgcttagatggtaaggcaaaa
aagatgagaaaaatagttgaactcgtagataagaaatcagggaggaaaatggagttatcc
ggaaaccaagcgggtttgcaattctataccggagggatgttaaaggatgtcaaagggaag
aatggggcagtttaccaagctttcgggggattatgtttagaaacacaaagttatccagac
gcattgaaccatcccaaatttccttcacagattgtcgagccagggaaaaaatacaaacac
actatgctcttcaagttttctattgtttcatag

DBGET integrated database retrieval system