KEGG   Arabidopsis thaliana (thale cress): AT5G15840Help
Entry
AT5G15840         CDS       T00041                                 

Gene name
CO
Definition
(RefSeq) zinc finger protein CONSTANS
  KO
K12135  
zinc finger protein CONSTANS
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G15840 (CO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 373 aa AA seqDB search
MLKQESNDIGSGENNRARPCDTCRSNACTVYCHADSAYLCMSCDAQVHSANRVASRHKRV
RVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRVPILPISGNSFSSMTTTH
HQSEKTMTDPEKRLVVDQEEGEEGDKDAKEVASWLFPNSDKNNNNQNNGLLFSDEYLNLV
DYNSSMDYKFTGEYSQHQQNCSVPQTSYGGDRVVPLKLEESRGHQCHNQQNFQFNIKYGS
SGTHYNDNGSINHNAYISSMETGVVPESTACVTTASHPRTPKGTVEQQPDPASQMITVTQ
LSPMDREARVLRYREKRKTRKFEKTIRYASRKAYAEIRPRVNGRFAKREIEAEEQGFNTM
LMYNTGYGIVPSF
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaacaagagagtaacgacataggtagtggagagaacaacagggcacgaccctgt
gacacatgccggtcaaacgcctgcaccgtgtattgccatgcagattctgcctacttgtgc
atgagctgtgatgctcaagttcactctgccaatcgcgttgcttcccgccataaacgtgtc
cgggtctgcgagtcatgtgagcgtgctccggctgcttttttgtgtgaggcagatgatgcc
tctctatgcacagcctgtgattcagaggttcattctgcaaacccacttgctagacgccat
cagcgagttccaattctaccaatttctggaaactctttcagctccatgaccactactcac
caccaaagcgagaaaacaatgaccgatccagagaagagactggtggtggatcaagaggaa
ggtgaagaaggtgataaggatgccaaggaggttgcttcgtggctgttccctaattcagac
aaaaataacaataaccaaaacaatgggttattgtttagtgatgagtatctaaaccttgtg
gattacaactcgagtatggactacaaattcacaggtgaatacagtcaacaccaacaaaac
tgcagcgtaccacagacgagctacgggggagatagagttgttccgcttaaacttgaagaa
tcaaggggccaccagtgccataaccaacagaattttcagttcaatatcaaatatggctcc
tcagggactcactacaacgacaatggttccattaaccataacgcatacatttcatccatg
gaaactggtgttgtgccggagtcaacagcatgtgtcacaacagcttcacacccaagaacg
cccaaagggacagtagagcaacaacctgaccctgcaagccagatgataacagtaacacaa
ctcagtccaatggacagagaagccagggtcctgagatacagagagaagaggaagacaagg
aaatttgagaagacaataaggtatgcttcgaggaaggcatatgcagagataagaccgcgg
gtcaatggccggttcgcaaagagagaaatcgaagccgaggagcaagggttcaacacgatg
ctaatgtacaacacaggatatgggattgttccttcattctga

DBGET integrated database retrieval system