KEGG   Arabidopsis thaliana (thale cress): AT5G15850Help
Entry
AT5G15850         CDS       T00041                                 

Gene name
COL1
Definition
(RefSeq) zinc finger protein CONSTANS-LIKE 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 355 aa AA seqDB search
MLKVESNWAQACDTCRSAACTVYCRADSAYLCSSCDAQVHAANRLASRHERVRVCQSCER
APAAFFCKADAASLCTTCDSEIHSANPLARRHQRVPILPISEYSYSSTATNHSCETTVTD
PENRLVLGQEEEDEDEAEAASWLLPNSGKNSGNNNGFSIGDEFLNLVDYSSSDKQFTDQS
NQYQLDCNVPQRSYGEDGVVPLQIEVSKGMYQEQQNFQLSINCGSWGALRSSNGSLSHMV
NVSSMDLGVVPESTTSDATVSNPRSPKAVTDQPPYPPAQMLSPRDREARVLRYREKKKMR
KFEKTIRYASRKAYAEKRPRIKGRFAKKKDVDEEANQAFSTMITFDTGYGIVPSF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtagagagtaactgggcacaagcctgtgatacatgccgatcagccgcctgc
accgtgtactgccgggctgattctgcctacttgtgctccagttgtgatgctcaagttcat
gctgccaatcgtcttgcttcccgccatgaacgtgttcgagtctgtcaatcatgtgagcga
gccccggctgcctttttctgcaaggcagatgctgcatctctatgcacaacctgtgattca
gagattcattccgcaaacccacttgctagacgccatcaacgagttccaattctgcccatt
tctgagtactcttacagttccacggccactaaccattcatgtgagacaacagtgacagat
ccagagaacagacttgtgcttggtcaagaagaagaggatgaagatgaagcagaggcggct
tcatggttgttgcctaattcagggaaaaacagtggtaacaacaatggcttctcgattggg
gatgagtttctgaaccttgttgattatagttcgagtgataagcaattcacagatcaatcc
aatcagtatcaactagactgcaacgtacctcagaggagctatggggaagatggagttgtt
ccacttcaaattgaagtatcaaagggcatgtaccaagagcaacagaactttcagctgagt
atcaactgtggctcctggggagctcttcgaagctccaatggttccctcagtcatatggtg
aatgtttcatctatggacctgggagttgtgccggagtcaacaacgagtgacgcaacagta
tcaaacccaagatcgcccaaagcggtaacagaccaaccaccttaccctccagctcagatg
ctcagtccaagggacagagaagctagagtcctgagatacagagagaagaagaagatgagg
aaatttgagaagacgataagatatgcttcaaggaaagcgtatgcagagaaaagaccacgg
atcaagggccggtttgcaaagaagaaagatgtcgatgaagaggcaaaccaagctttctcc
acaatgataacatttgacaccggatatggaattgttccatcattctga

DBGET integrated database retrieval system