KEGG   Arabidopsis thaliana (thale cress): AT5G16310Help
Entry
AT5G16310         CDS       T00041                                 

Gene name
UCH1
Definition
ubiquitin thiolesterase UCH1
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 334 aa AA seqDB search
MSWLPVESDPGIFTEIIQQMQVKGVQVEELYSLDFNSLDEIRPVYGLILLYKWRPEEKEN
RVVITEPNPNFFFASQIINNACATQAILSVLMNSSSIDIGSELSELKQFAKEFPPELKGL
AINNNEAIRAAHNTFARPDPSSIMEDEELAAAKNLDEDDDVYHYISYLPVDGILYELDGL
KEGPISLGQCLGEPEGIEWLRMVQPVVQEQIDRYSQNEIRFSLLAVVKNRKEMYVAELKE
YQRKRERVLQQLGALQADKYAEKSSYEALDRELSEVNIGIETVSQKIVMEEEKSKNWKKE
NMRRKHNYVPFLFNFLKILADKKKLKPLIAKHHP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcttcctgtagaatctgatcctggtattttcactgagattatacaacaaatg
caagtgaaaggtgtgcaggttgaggaattgtattccttggacttcaactctctggatgaa
ataagacctgtctatggattgatattgctttacaagtggcgtccagaagaaaaggagaat
cgtgttgtcatcacagagccaaacccgaatttcttctttgcaagccagataatcaacaat
gcttgtgcgacccaagcgatattatcagtcctcatgaactcttcgagtattgatattggc
tcagaactatcagaactgaaacaattcgccaaagaatttcctcctgaactgaaaggttta
gccatcaacaacaatgaggcaatacgtgcagctcacaacacatttgccaggcctgacccg
tcttccatcatggaagatgaagaattagctgctgcgaaaaatctagacgaagatgatgat
gtgtatcattacatcagctacttacctgttgatggtatcttatatgagctcgatggtctt
aaagaaggacccattagtcttggacagtgtctgggtgagccagaaggaatcgagtggctc
agaatggtccaacctgtggtacaagagcagattgaccggtattcgcagaatgagattcgg
tttagtctcttagctgtagttaagaacaggaaagagatgtatgtagctgaactgaaagag
tatcaaagaaagcgagagagggttttgcagcagttaggtgctttgcaagctgataaatac
gctgagaaaagcagttacgaggctcttgatagagagctttcggaagtcaatatcgggata
gagactgtttcacaaaagattgtaatggaggaggagaaatctaagaactggaagaaagag
aacatgagaaggaaacacaactatgtccctttcctcttcaacttcctcaagattcttgct
gacaagaagaagctgaaacctctcattgctaagcaccatccctaa

DBGET integrated database retrieval system