KEGG   Arabidopsis thaliana (thale cress): AT5G17010Help
Entry
AT5G17010         CDS       T00041                                 

Definition
(RefSeq) D-xylose-proton symporter-like 2
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 503 aa AA seqDB search
MALDPEQQQPISSVSREFGKSSGEISPEREPLIKENHVPENYSVVAAILPFLFPALGGLL
YGYEIGATSCATISLQSPSLSGISWYNLSSVDVGLVTSGSLYGALFGSIVAFTIADVIGR
RKELILAALLYLVGALVTALAPTYSVLIIGRVIYGVSVGLAMHAAPMYIAETAPSPIRGQ
LVSLKEFFIVLGMVGGYGIGSLTVNVHSGWRYMYATSVPLAVIMGIGMWWLPASPRWLLL
RVIQGKGNVENQREAAIKSLCCLRGPAFVDSAAEQVNEILAELTFVGEDKEVTFGELFQG
KCLKALIIGGGLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGLLKLIMTGV
AVVVIDRLGRRPLLLGGVGGMVVSLFLLGSYYLFFSASPVVAVVALLLYVGCYQLSFGPI
GWLMISEIFPLKLRGRGLSLAVLVNFGANALVTFAFSPLKELLGAGILFCGFGVICVLSL
VFIFFIVPETKGLTLEEIEAKCL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgatcctgagcagcagcaaccaatctcctctgtttccagagagtttggtaag
tcatctggtgagatcagcccagaaagggagcctcttattaaagagaatcatgtcccagaa
aactactctgtcgttgccgccattctcccgtttttatttccagctctcggaggactgctt
tatggttatgaaattggtgcaacttcttgtgcaaccatttcacttcagtcgccttcatta
agtggaatttcatggtacaacttgtcctcagtggatgttggtctagttaccagtggctca
ctttacggtgcattatttggctcaattgtggcttttactatcgctgacgttataggaaga
agaaaggagctgattttggctgcattattgtatctcgttggagcccttgtgactgcacta
gccccaacctattccgttctgataattggacgggttatttatggggtctcagttggactg
gcaatgcatgcggctccgatgtacattgcagagactgctccaagtccgatacgtggacag
ctggtatcattaaaggaattcttcatagtccttgggatggttggaggttatggaatcggt
agtcttacagtcaatgttcattctggttggcgatacatgtatgcaacaagtgtccctttg
gcagttattatgggaattgggatgtggtggctcccagcatcccctaggtggcttttgttg
cgcgtcatacaggggaaagggaatgtggagaaccaacgagaggctgcaatcaaatctctc
tgctgccttagaggccctgcttttgttgattcagctgctgaacaagtaaatgagattttg
gctgaactaacttttgtgggcgaggataaagaagtcacatttggtgaattatttcaaggg
aagtgcttgaaagctctcatcataggaggaggtctagtcttgtttcagcagataactgga
caaccaagtgtgctttattatgcaccatcaatactgcagaccgctggcttttcagccgca
ggtgatgcaacaagggtctcaattctacttggtctattgaagttgattatgacaggagta
gctgttgtagttatcgacagacttggaaggagacctttacttcttggtggagttggtggc
atggttgtttcattattcctgctggggtcatactacctctttttcagcgcctcaccagtt
gttgctgtagttgcactgctgctttatgtgggctgttaccagctatcttttggtccaatt
ggttggctgatgatttcagagatatttccccttaaactaagaggtcgaggtctcagtcta
gcagtgcttgtgaattttggtgcaaacgcacttgtgacatttgcgttttcacccctaaag
gaactgctgggagctgggatactgttttgtgggtttggtgtgatatgtgtattgtctctg
gtattcatattcttcattgtgccagagacaaagggtctcactcttgaggaaattgaagcc
aaatgtctctaa

DBGET integrated database retrieval system