KEGG   Arabidopsis thaliana (thale cress): AT5G17770Help
Entry
AT5G17770         CDS       T00041                                 

Gene name
CBR
Definition
(RefSeq) NADH:cytochrome B5 reductase 1
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AT5G17770 (CBR)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     AT5G17770 (CBR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 831645
NCBI-ProteinID: NP_197279
MIPS: AT5G17770.1
TAIR: AT5G17770
Araport: AT5G17770
UniProt: Q9ZNT1 A0A178US77
Position
5
AA seq 281 aa AA seqDB search
MDTEFLRTLDRQILLGVFVAFVAVGAGAAYFLTSSKKRRVCLDPENFKEFKLVKRHQLSH
NVAKFVFELPTSTSVLGLPIGQHISCRGKDGQGEDVIKPYTPTTLDSDVGRFELVIKMYP
QGRMSHHFREMRVGDHLAVKGPKGRFKYQPGQFRAFGMLAGGSGITPMFQVARAILENPT
DKTKVHLIYANVTYDDILLKEELEGLTTNYPEQFKIFYVLNQPPEVWDGGVGFVSKEMIQ
THCPAPASDIQILRCGPPPMNKAMAANLEALGYSPEMQFQF
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggataccgagtttctccgaaccctagatcgtcagattcttttgggtgtcttcgttgct
ttcgtcgccgttggtgctggtgctgcttattttcttacatcctccaagaaacgcagagtg
tgtttggatccagagaatttcaaggagttcaagcttgttaagagacatcagcttagtcac
aatgtggccaagttcgtttttgaactcccaacttctacttctgtgttgggtcttcccatt
ggacaacacatcagttgcaggggaaaggatggtcaaggagaggatgttattaagccatac
accccgactacgttagactctgacgttggacgtttcgaacttgtcattaagatgtatccg
caaggacggatgtctcatcatttcagggagatgcgtgttggagaccatcttgccgtaaag
ggaccaaagggtaggttcaagtatcaaccaggtcagtttagggcatttggaatgcttgct
ggaggttcaggcatcactcccatgttccaagtggccagagcaattctagaaaacccaaca
gacaagacaaaggtgcatctcatttacgccaacgtcacatacgacgacattctcttgaag
gaagaattggagggtcttactaccaattaccctgaacaatttaaaatcttctatgttttg
aaccagcctccggaagtatgggatggtggtgttggatttgtatcaaaggaaatgattcag
actcattgccctgcacctgcatctgatattcagatcctaagatgcggaccaccgccaatg
aacaaggccatggctgcaaaccttgaagctctgggatactctccggagatgcaattccag
ttctga

DBGET integrated database retrieval system