KEGG   Arabidopsis thaliana (thale cress): AT5G18110Help
Entry
AT5G18110         CDS       T00041                                 

Gene name
NCBP
Definition
translation initiation factor NCBP
Orthology
K03259  
translation initiation factor 4E
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AT5G18110 (NCBP)
Translation factors [BR:ath03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AT5G18110 (NCBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 221 aa AA seqDB search
MEVLDRRDDEIRDSGNMDSIKSHYVTDSVSEERRSRELKDGDHPLRYKFSIWYTRRTPGV
RNQSYEDNIKKMVEFSTVEGFWACYCHLARSSLLPSPTDLHFFKDGIRPLWEDGANCNGG
KWIIRFSKVVSARFWEDLLLALVGDQLDDADNICGAVLSVRFNEDIISVWNRNASDHQAV
MGLRDSIKRHLKLPHAYVMEYKPHDASLRDNSSYRNTWLRG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggaggttttggataggagagacgatgagatcagggactcgggaaacatggacagcatc
aagtcacactatgttaccgactctgtttccgaggaacgccgctctcgtgagctcaaggat
ggagaccatcctttacggtacaagttttcgatatggtacactcgtcgcacaccaggggtt
cggaaccagtcttatgaagataacatcaagaagatggtagaattcagcacggttgaagga
ttttgggcctgctactgtcaccttgctcgttcttctctcttgcctagtccaacagatctt
catttctttaaggatgggattcgtccattgtgggaggatggtgccaactgcaatggagga
aagtggatcatacgtttctcaaaagttgtatctgctcgcttctgggaggatctgcttctt
gcgttggtaggcgaccagcttgatgatgctgataacatatgtggggcagtactgagtgtc
cgtttcaacgaggacatcattagtgtatggaatcgcaatgcttctgaccatcaggcagtg
atgggtttgagagactcaatcaagcggcatttgaagttgcctcatgcatatgtcatggaa
tacaagccacacgatgcttctctccgcgacaactcttcctacagaaacacatggctgaga
ggatag

DBGET integrated database retrieval system