KEGG   Arabidopsis thaliana (thale cress): AT5G18840Help
Entry
AT5G18840         CDS       T00041                                 

Definition
(RefSeq) sugar transporter ERD6-like 16
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 482 aa AA seqDB search
MAIREIKDVERGEIVNKVEDLGKPFLTHEDDEKESENNESYLMVLFSTFVAVCGSFEFGS
CVGYSAPTQSSIRQDLNLSLAEFSMFGSILTIGAMLGAVMSGKISDFSGRKGAMRTSACF
CITGWLAVFFTKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGGLTTLNQLMIV
IGSSVSFLIGSLISWKTLALTGLAPCIVLLFGLCFIPESPRWLAKAGHEKEFRVALQKLR
GKDADITNEADGIQVSIQALEILPKARIQDLVSKKYGRSVIIGVSLMVFQQFVGINGIGF
YASETFVKAGFTSGKLGTIAIACVQVPITVLGTILIDKSGRRPLIMISAGGIFLGCILTG
TSFLLKGQSLLLEWVPSLAVGGVLIYVAAFSIGMGPVPWVIMSEIFPINVKGIAGSLVVL
VNWSGAWAVSYTFNFLMSWSSPGTFYLYSAFAAATIIFVAKMVPETKGKTLEEIQACIRR
ET
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggccattagggaaatcaaagatgtagagaggggtgaaatagtgaataaggtagaagat
cttgggaaaccatttttgactcatgaagatgatgaaaaagagagtgagaataatgaatca
tatttgatggttctcttcagtacttttgttgctgtctgtggctcctttgagtttggctct
tgtgttggatactcagcgcctactcagtcatctataagacaagatctcaatctctccctt
gcagagttctccatgtttggatccatcttaactatcggtgcaatgcttggtgctgttatg
agtgggaaaatttcagatttctccggccgaaaaggggcaatgaggacatcagcttgcttc
tgcattacaggttggctcgctgtcttcttcaccaagggggcattgttacttgatgtagga
aggttctttacaggatatggaattggagttttttcttatgtggtccctgtgtacattgct
gagatatctcccaagaatctccgaggtggactcacaacactgaaccaactcatgattgtg
atcggctcatcggtttctttcttgatcggatctctcatttcttggaaaactcttgcccta
accggacttgctccctgcattgttttgctctttggcttgtgcttcatacccgaatctcct
cgatggctggcaaaagcaggccatgagaaagagtttcgcgtagccctgcaaaagctgcga
ggaaaagatgcagatatcacaaatgaagcagacggtattcaagtctcgattcaagctcta
gagattcttccaaaagcaagaatccaagaccttgtgtccaagaaatatggtcgatctgtc
atcattggtgtttccctgatggtattccaacagtttgttggaatcaatgggatcggattc
tacgcaagtgaaacgtttgtaaaagccggatttacctctgggaaactaggaacaatcgct
atcgcttgtgttcaggtgccaataactgttcttggaacaatcttgatagataaatctgga
cgaaggccactaattatgatttcagctggtggtatcttcttgggatgcatactcacaggc
acatctttcttactcaagggacagagcttgttgcttgaatgggtcccttccttagccgtt
ggaggtgtacttatctatgtagctgctttctccatcggaatgggacctgttccttgggtg
ataatgtctgagatatttccgataaacgtaaagggaatcgcaggaagcttagtggtacta
gtgaattggtctggtgcttgggctgtttcttacactttcaacttcctcatgagctggagc
tctccaggtacattctatttgtactcggcttttgcagctgcgacgataatatttgtggcg
aagatggtgccagagacgaaagggaagacactggaagagatccaagcttgtattcgaaga
gaaacataa

DBGET integrated database retrieval system