KEGG   Arabidopsis thaliana (thale cress): AT5G19310Help
Entry
AT5G19310         CDS       T00041                                 

Definition
(RefSeq) homeotic protein regulator
  KO
K11647  
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2/4 [EC:3.6.4.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     AT5G19310
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     AT5G19310
Chromosome [BR:ath03036]
 Eukaryotic Type
  Chromatin remodeling factors
   BAF complex
    AT5G19310
   PBAF complex
    AT5G19310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 1064 aa AA seqDB search
MVKQLQEQEENDPVEKTKSLISALNYLSRDLLLPSHLYASVSSIYHASVSDLSPSPPLRG
NSYTPNRGDLMSEFEDALLQQRLNYESGSRLAELKETRYKNRIHNRLSQLEGLPSNRGED
LQEKCLLELYGLKLQELQCRVRGEVSAEYWLRLNCADPERQLYDWGMMRLPRRMYGVGDS
FVMEADDQFRNKRDAERLLRLEEEEKNLIETTQRKFFAEVLNAVREFQLQIQASHRRCKQ
RNDGVQAWHGKQRQRATRAEKLRIMALKSDDQEEYMKLAKESKNEKLTLFLEETNKIFVS
LGAAVQRQKDAKLSENTKLLKGSESDLSDVDAPEDVLPAQDIEIIDSDNNDDSNDLLEGE
RQFNLAIHSIQEKVTKQPSLLQGGELRSYQLEGLQWMVSLYNNDYNGILADEMGLGKTIQ
TIALIAYLLESKDLHGPHLILAPKAVLPNWENEFALWAPSISAFLYDGSKEKRTEIRARI
AGGKFNVLITHYDLIMRDKAFLKKIDWNYMIVDEGHRLKNHECALAKTLGTGYRIKRRLL
LTGTPIQNSLQELWSLLNFLLPHIFNSIHNFEEWFNTPFAECGSASLTDEEELLIINRLH
HVIRPFLLRRKKSEVEKFLPGKTQVILKCDMSAWQKLYYKQVTDVGRVGLHSGNGKSKSL
QNLTMQLRKCCNHPYLFVGADYNMCKKPEIVRASGKFELLDRLLPKLKKAGHRILLFSQM
TRLIDLLEIYLSLNDYMYLRLDGSTKTDQRGILLKQFNEPDSPYFMFLLSTRAGGLGLNL
QTADTIIIFDSDWNPQMDQQAEDRAHRIGQKKEVRVFVLVSIGSIEEVILERAKQKMGID
AKVIQAGLFNTTSTAQDRREMLEEIMSKGTSSLGEDVPSEREINRLAARTEEEFWMFEQM
DEERRKKENYKTRLMEEKEVPEWAYTSETQEDKTNAKNHFGSLTGKRKRKEAVYSDSLSD
LQWMKAMESEDEDASKVSQKRKRTDTKTRMSNGSKAEAVLSESDEEKEEEEEERKEESGK
ESEEENEKPLHSWKTNKKKRSRYPVMTSSPNSRGKGSSKGSKRN
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagcagctacaagagcaggaggagaacgatcccgtcgagaagacaaagtctctg
atctctgctcttaactacctttctcgcgaccttctcttgccttctcacctttacgcttcc
gtttcttctatttaccatgcctccgtctccgatctctctccttctccgcctcttcgtgga
aatagttatactcccaatagaggtgatttgatgagcgagttcgaagatgcacttttgcaa
cagcgactaaactatgaatcaggctctcgactagccgagttaaaggaaactcggtataag
aatcgtatccacaaccgattatctcaacttgaaggattaccttccaatagaggtgaagat
ttgcaggaaaaatgcttacttgagctttatggtcttaagttacaagaactacaatgcagg
gttcggggtgaggtgagtgcggaatactggctgcgtttgaattgtgcagatccggagaga
caactatatgattggggcatgatgcggttgcctcgccgaatgtatggggttggagattct
tttgttatggaagctgatgatcagttcaggaacaagcgtgatgccgagaggttattacgg
ttagaagaagaggagaagaatctgattgaaacgacacagaggaaattctttgcagaagta
ctcaatgctgttcgtgaattccagttgcaaattcaggcgtctcatagacggtgtaagcaa
agaaatgatggtgtccaggcctggcatggaaagcaaaggcaacgtgccacccgagctgaa
aaactaaggatcatggcccttaaatctgatgatcaagaggaatacatgaaactagcaaag
gaaagtaagaacgaaaaactaaccctttttctagaggagacaaacaaaatctttgttagt
ttgggggctgcagtccagcgtcagaaagatgccaaactttcagaaaacaccaaattactg
aaaggctcagaatctgacttatctgatgttgatgctcctgaggatgtgcttcctgcccaa
gatattgagatcattgactctgacaataatgatgattctaatgacttactagaaggcgag
aggcagtttaacttggctatccattccatacaagagaaggtgacaaagcagccatccctt
ctacaaggtggggaactaagatcctatcaattagaaggacttcaatggatggtctctcta
tacaacaatgactataatggcattttagctgatgaaatgggtttaggaaagactatccaa
acgattgcactgattgcgtatcttcttgagagtaaagatcttcatgggcctcatctaata
ttggctccaaaagctgtgctaccaaattgggaaaatgagtttgcattatgggcacccagc
atttccgcttttctttacgatggatcaaaggagaaaagaactgaaataagagcaagaata
gcaggaggaaaatttaatgtgttgataacccactacgatcttatcatgagagataaagca
tttttgaagaaaattgactggaactacatgattgttgatgaaggacatcgtctgaagaac
catgaatgtgctctcgcaaagactctaggaactggctaccggattaagcgcagacttcta
ttaactggaactcccatacagaacagtctgcaagaactatggtcgctgcttaattttctt
cttcctcacatctttaactcaattcataatttcgaagaatggtttaatactccattcgca
gaatgtggtagtgccagtcttacagatgaagaggagctgttgattattaaccgtctgcat
catgtcataaggccgtttctactgagaaggaaaaaaagtgaggttgagaaattccttcct
ggaaagacacaagtcatactgaagtgtgatatgtcggcttggcaaaaattgtattacaaa
caagttacagacgtaggcagggtcggtcttcattctggcaatgggaaatcaaagagtctg
cagaatctgacaatgcaattaagaaagtgttgtaaccatccgtacctattcgttggagca
gattataacatgtgtaagaagcctgagattgtgagagcttcaggaaaattcgagttactt
gatcgcctccttccaaaactgaagaaagctggacatagaattctgctcttttctcaaatg
actcgtctcattgaccttctcgaaatttacttgtcactcaatgactacatgtacctcaga
cttgacggtagcacaaagacagaccaaagagggattttactgaagcaattcaacgaaccg
gactctccctactttatgtttcttctgagcacacgtgctggtggtcttggtttgaactta
caaactgcagacactataattatatttgacagtgattggaatccacaaatggaccagcaa
gcagaggatcgtgctcatcggatagggcagaaaaaggaagtgagagtttttgttttggtt
agcattggatccattgaagaagtaatattggagcgtgcaaagcaaaagatgggcatcgat
gcgaaagtcatacaagcagggctcttcaacacaacttctactgctcaagacaggagagag
atgctggaagagatcatgagcaaaggaacaagctcactgggagaagatgtgccaagtgag
agagagattaaccggctcgcagctcgaactgaggaagagttttggatgtttgaacaaatg
gacgaggaaagacgtaaaaaggagaactacaagacacgtctcatggaagagaaggaagtt
cccgagtgggcttacacttcagagactcaagaagacaagactaacgcgaaaaaccatttt
ggtagcctcacgggtaaacggaaacgaaaagaagcagtgtatagcgactctttaagcgat
ttgcagtggatgaaagcgatggagagtgaagacgaagatgcttccaaagtctctcagaaa
cgaaagagaacggacacaaagacaagaatgagtaatgggtcaaaggcagaggctgtgttg
agtgaaagcgatgaggaaaaagaagaagaagaagaagaaaggaaggaggagagtgggaaa
gagagtgaagaagaaaatgagaagccattacatagttggaaaactaataagaagaaacgg
tcaagataccctgttatgacttcttcacctaattctagaggtaaaggtagctcaaaagga
agtaaacgaaactga

DBGET integrated database retrieval system