KEGG   Arabidopsis thaliana (thale cress): AT5G19730Help
Entry
AT5G19730         CDS       T00041                                 

Definition
(RefSeq) Pectin lyase-like superfamily protein
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00040  Pentose and glucuronate interconversions
ath01100  Metabolic pathways
Module
ath_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AT5G19730
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AT5G19730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-GeneID: 832093
NCBI-ProteinID: NP_197474
MIPS: AT5G19730.1
TAIR: AT5G19730
Araport: AT5G19730
UniProt: Q8VYZ3
Position
5
AA seq 383 aa AA seqDB search
MPKLNSTQAPNLFLLLLVILLCSTQTQCHTKGLRLRPRNQKNMNTTSDRTQNPEDEFMKW
VRFVGSLKHSVFKAAKNKLFPSYTLTVHKKSNKGDFTKIQDAIDSLPLINFVRVVIKVHA
GVYKEKVSIPPLKAFITIEGEGAEKTTVEWGDTAQTPDSKGNPMGTYNSASFAVNSPFFV
AKNITFRNTTPVPLPGAVGKQAVALRVSADNAAFFGCRMLGAQDTLYDHLGRHYYKDCYI
EGSVDFIFGNALSLYEGCHVHAIADKLGAVTAQGRSSVLEDTGFSFVKCKVTGTGVLYLG
RAWGPFSRVVFAYTYMDNIILPRGWYNWGDPSREMTVFYGQYKCTGAGANYGGRVAWARE
LTDEEAKPFLSLTFIDGSEWIKL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaactcaattcaacccaagctcccaatttattccttctccttctcgttatcctt
ctttgttcaacgcaaacacaatgccacaccaaaggtctccgattacgaccaagaaaccag
aagaatatgaacacgacgagtgatcggacacaaaacccggaagatgagttcatgaaatgg
gtgagattcgttggaagccttaaacactcagtgttcaaggcagccaagaacaaactcttc
ccttcttatacattaactgtccacaagaaatccaataaaggtgacttcactaaaatccaa
gacgccattgattctctccctctcatcaactttgttcgtgtcgtcatcaaagttcatgcc
ggagtttacaaggagaaggtgagcatacccccactgaaggcatttataacaatagaagga
gaaggagcagagaagacaacagtggaatggggagacacagcacaaacccctgactcaaaa
ggcaaccccatgggcacttacaactcggcctcgttcgcggtcaactctcctttctttgtc
gctaagaatatcacattcaggaacacgaccccagtccccttgcccggtgcagttggtaaa
caggcggtagcattgagggtgtcggcagacaatgccgcgttttttgggtgtagaatgctt
ggtgctcaagacactctctatgaccatttgggaagacattattacaaagattgttacatt
gagggatcagtggacttcatctttggaaatgccctttctctttatgaagggtgccacgtg
catgcgatagcggataagctaggagcagtgacggcacaggggaggagcagtgttctagag
gacaccggattctcgttcgtaaagtgtaaggtgacagggacaggggttttgtatcttggg
agggcatggggtcccttctcaagagtcgtttttgcttacacttacatggacaacatcatc
ctccctagaggctggtacaattggggagacccttcccgtgagatgacggtgttctatggg
cagtacaagtgcacgggagcaggagcaaactatggagggagggtggcttgggcaagagag
ctcaccgacgaagaagctaagccttttctttctcttacctttatcgacggctctgaatgg
atcaaactctaa

DBGET integrated database retrieval system