KEGG   Arabidopsis thaliana (thale cress): AT5G20060Help
Entry
AT5G20060         CDS       T00041                                 

Definition
phospholipase/carboxylesterase family protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AT5G20060
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AT5G20060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 252 aa AA seqDB search
MSISGAAVGSGRNLRRAVEFGKTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLPLPN
IKWICPTAPSQPISLFGGFPSTAWFDVVDINEDGPDDMEGLDVAAAHVANLLSNEPADIK
LGVGGFSMGAATSLYSATCFALGKYGNGNPYPINLSAIIGLSGWLPCAKTLAGKLEEEQI
KNRAASLPIVVCHGKADDVVPFKFGEKSSQALLSNGFKKVTFKPYSALGHHTIPQELDEL
CAWLTSTLSLEG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtatctccggtgctgcagttggttcaggcagaaatttaagaagagcggtagagttt
gggaaaactcatgtggttaggcctaaagggaaacatcaagcaactattgtctggttacat
gggcttggggacaatggctcgagctggtcccagcttttggagacccttccccttccaaat
atcaaatggatttgcccgactgctccttctcaaccaataagtttatttggtggttttccc
tccacagcttggtttgatgttgtggacatcaatgaagatggacctgatgatatggaagga
ttggatgtggctgctgcacatgttgcaaatctgttgtcgaatgagcctgctgacattaaa
ttaggtgttggaggattcagcatgggtgcggcgacatctctatattctgcaacttgtttt
gctctcggtaaatatggaaatggcaatccataccctatcaatttaagcgcaatcataggc
ttaagcggctggcttccttgtgcaaagacattggctggcaaactagaagaggaacagatc
aagaaccgagctgcatcgttgcccattgttgtctgtcatggaaaagctgatgatgtggta
ccgttcaagtttggggagaaatcttcacaggctttgctttcaaatgggtttaagaaggtg
accttcaaaccttacagtgcacttggtcaccacacaatcccacaggagttggatgagttg
tgcgcatggttgacatccacgctcagcctcgaaggttga

DBGET integrated database retrieval system