KEGG   Arabidopsis thaliana (thale cress): AT5G20060Help
Entry
AT5G20060         CDS       T00041                                 

Definition
phospholipase/carboxylesterase family protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ath00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 252 aa AA seqDB search
MSISGAAVGSGRNLRRAVEFGKTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLPLPN
IKWICPTAPSQPISLFGGFPSTAWFDVVDINEDGPDDMEGLDVAAAHVANLLSNEPADIK
LGVGGFSMGAATSLYSATCFALGKYGNGNPYPINLSAIIGLSGWLPCAKTLAGKLEEEQI
KNRAASLPIVVCHGKADDVVPFKFGEKSSQALLSNGFKKVTFKPYSALGHHTIPQELDEL
CAWLTSTLSLEG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtatctccggtgctgcagttggttcaggcagaaatttaagaagagcggtagagttt
gggaaaactcatgtggttaggcctaaagggaaacatcaagcaactattgtctggttacat
gggcttggggacaatggctcgagctggtcccagcttttggagacccttccccttccaaat
atcaaatggatttgcccgactgctccttctcaaccaataagtttatttggtggttttccc
tccacagcttggtttgatgttgtggacatcaatgaagatggacctgatgatatggaagga
ttggatgtggctgctgcacatgttgcaaatctgttgtcgaatgagcctgctgacattaaa
ttaggtgttggaggattcagcatgggtgcggcgacatctctatattctgcaacttgtttt
gctctcggtaaatatggaaatggcaatccataccctatcaatttaagcgcaatcataggc
ttaagcggctggcttccttgtgcaaagacattggctggcaaactagaagaggaacagatc
aagaaccgagctgcatcgttgcccattgttgtctgtcatggaaaagctgatgatgtggta
ccgttcaagtttggggagaaatcttcacaggctttgctttcaaatgggtttaagaaggtg
accttcaaaccttacagtgcacttggtcaccacacaatcccacaggagttggatgagttg
tgcgcatggttgacatccacgctcagcctcgaaggttga

DBGET integrated database retrieval system