KEGG   Arabidopsis thaliana (thale cress): AT5G20150Help
Entry
AT5G20150         CDS       T00041                                 

Gene name
SPX1
Definition
(RefSeq) SPX domain-containing protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 256 aa AA seqDB search
MKFGKSLSNQIEQTLPEWQDKFLSYKELKKRLKLIGSKTADRPVKRLRLDEFSVGISKEE
INFIQLLEDELEKFNNFFVEKEEEYIIRLKEFRDRIAKAKDSMEKMIKIRKEIVDFHGEM
VLLENYSALNYTGLVKILKKYDKRTGDLMRLPFIQKVLQQPFYTTDLLFKLVKESEAMLD
QIFPANETESEIIQAELSEHKFMESLHMKSTIAALRVLKEIRSGSSTVSVFSLPPLQLNG
LDETWKKIPLLEQEAK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttggtaagagtctcagcaatcagatcgagcaaactcttcctgaatggcaagac
aagttcttgtcttacaaagaactcaaaaaacgactcaaactcatcggttccaaaaccgcc
gatcgtcccgttaaacgactccgtttagatgagttttccgtcggaatatcgaaagaagag
atcaatttcatccaattgttagaagacgagttggagaaattcaacaatttcttcgttgag
aaggaagaagaatatatcatcagactaaaggaatttagagatagaattgcgaaagctaag
gattcaatggagaagatgataaaaatcaggaaggagattgttgatttccatggagaaatg
gttcttcttgagaattacagtgctcttaattacactggattggttaagatactgaagaag
tatgacaaaagaactggtgatctcatgcgtttacctttcatccagaaagttcttcagcaa
cctttttacactactgacttattgttcaagcttgtcaaggaatctgaggcaatgcttgat
cagatcttccctgctaacgaaactgagtctgagattatccaagcagagttatcagagcat
aagttcatggagagtcttcatatgaagagcacaatcgctgccttgcgggttttgaaggag
atcaggagtggaagttctactgttagtgtgttttcattgccgcctctacagttaaatggc
ttagatgagacatggaagaagattccattgttggagcaagaagccaaatag

DBGET integrated database retrieval system