KEGG   Arabidopsis thaliana (thale cress): AT5G20150Help
Entry
AT5G20150         CDS       T00041                                 

Gene name
SPX1
Definition
(RefSeq) SPX domain-containing protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: SPX
Motif
Other DBs
NCBI-GeneID: 832137
NCBI-ProteinID: NP_197515
MIPS: AT5G20150.1
TAIR: AT5G20150
Araport: AT5G20150
UniProt: Q8LBH4
Position
5
AA seq 256 aa AA seqDB search
MKFGKSLSNQIEQTLPEWQDKFLSYKELKKRLKLIGSKTADRPVKRLRLDEFSVGISKEE
INFIQLLEDELEKFNNFFVEKEEEYIIRLKEFRDRIAKAKDSMEKMIKIRKEIVDFHGEM
VLLENYSALNYTGLVKILKKYDKRTGDLMRLPFIQKVLQQPFYTTDLLFKLVKESEAMLD
QIFPANETESEIIQAELSEHKFMESLHMKSTIAALRVLKEIRSGSSTVSVFSLPPLQLNG
LDETWKKIPLLEQEAK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttggtaagagtctcagcaatcagatcgagcaaactcttcctgaatggcaagac
aagttcttgtcttacaaagaactcaaaaaacgactcaaactcatcggttccaaaaccgcc
gatcgtcccgttaaacgactccgtttagatgagttttccgtcggaatatcgaaagaagag
atcaatttcatccaattgttagaagacgagttggagaaattcaacaatttcttcgttgag
aaggaagaagaatatatcatcagactaaaggaatttagagatagaattgcgaaagctaag
gattcaatggagaagatgataaaaatcaggaaggagattgttgatttccatggagaaatg
gttcttcttgagaattacagtgctcttaattacactggattggttaagatactgaagaag
tatgacaaaagaactggtgatctcatgcgtttacctttcatccagaaagttcttcagcaa
cctttttacactactgacttattgttcaagcttgtcaaggaatctgaggcaatgcttgat
cagatcttccctgctaacgaaactgagtctgagattatccaagcagagttatcagagcat
aagttcatggagagtcttcatatgaagagcacaatcgctgccttgcgggttttgaaggag
atcaggagtggaagttctactgttagtgtgttttcattgccgcctctacagttaaatggc
ttagatgagacatggaagaagattccattgttggagcaagaagccaaatag

DBGET integrated database retrieval system